SitesBLAST
Comparing BPHYT_RS20960 FitnessBrowser__BFirm:BPHYT_RS20960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
40% identity, 74% coverage: 73:309/320 of query aligns to 68:310/334 of 5aovA
- active site: L100 (= L105), R241 (= R240), D265 (= D264), E270 (= E269), H288 (= H287)
- binding glyoxylic acid: Y74 (≠ A79), A75 (≠ S80), V76 (≠ A81), G77 (= G82), R241 (= R240), H288 (= H287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A81), T104 (= T109), F158 (= F159), G159 (= G160), R160 (= R161), I161 (= I162), S180 (≠ D181), R181 (≠ I182), A211 (≠ H212), V212 (= V213), P213 (= P214), T218 (≠ G217), I239 (≠ A238), A240 (= A239), R241 (= R240), H288 (= H287), G290 (≠ A289)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
43% identity, 75% coverage: 73:312/320 of query aligns to 67:312/332 of 6biiA
- active site: L99 (= L105), R240 (= R240), D264 (= D264), E269 (= E269), H287 (= H287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A81), T103 (= T109), G156 (= G158), F157 (= F159), G158 (= G160), R159 (= R161), I160 (= I162), A179 (≠ D181), R180 (≠ I182), S181 (≠ N183), K183 (≠ A185), V211 (= V213), P212 (= P214), E216 (≠ G216), T217 (≠ G217), V238 (≠ A238), A239 (= A239), R240 (= R240), D264 (= D264), H287 (= H287), G289 (≠ A289)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
40% identity, 84% coverage: 52:320/320 of query aligns to 48:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
40% identity, 84% coverage: 52:320/320 of query aligns to 46:310/311 of 3bazA
- active site: L98 (= L105), R230 (= R240), A251 (= A261), D254 (= D264), E259 (= E269), H277 (= H287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A81), G149 (= G158), L150 (≠ F159), G151 (= G160), R152 (= R161), I153 (= I162), S172 (≠ N183), R173 (= R184), S174 (≠ A185), C201 (≠ V213), P202 (= P214), T207 (≠ V218), I228 (≠ A238), G229 (≠ A239), R230 (= R240), D254 (= D264), H277 (= H287), G279 (≠ A289)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
36% identity, 99% coverage: 5:320/320 of query aligns to 1:309/319 of 5v7nA
- active site: L95 (= L105), R229 (= R240), D253 (= D264), E258 (= E269), H276 (= H287)
- binding 2-keto-D-gluconic acid: G70 (≠ S80), V71 (≠ A81), G72 (= G82), R229 (= R240), H276 (= H287), S279 (= S290), R285 (= R296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (≠ A81), V99 (≠ T109), L149 (≠ F159), G150 (= G160), R151 (= R161), I152 (= I162), T171 (= T180), R172 (≠ D181), V200 (= V213), P201 (= P214), S205 (≠ V218), T206 (≠ P219), V227 (≠ A238), G228 (≠ A239), R229 (= R240), H276 (= H287), A278 (= A289)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
36% identity, 99% coverage: 5:320/320 of query aligns to 2:310/319 of 5v6qB
- active site: L96 (= L105), R230 (= R240), D254 (= D264), E259 (= E269), H277 (= H287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (≠ A81), V100 (≠ T109), F148 (≠ V157), L150 (≠ F159), G151 (= G160), R152 (= R161), I153 (= I162), T172 (= T180), R173 (≠ D181), V201 (= V213), P202 (= P214), S206 (≠ V218), T207 (≠ P219), V228 (≠ A238), G229 (≠ A239), R230 (= R240), H277 (= H287), A279 (= A289)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
36% identity, 98% coverage: 6:320/320 of query aligns to 1:308/318 of 5j23A
- active site: L94 (= L105), R228 (= R240), D252 (= D264), E257 (= E269), H275 (= H287)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (≠ A81), L148 (≠ F159), G149 (= G160), R150 (= R161), I151 (= I162), T170 (= T180), R171 (≠ D181), P200 (= P214), S204 (≠ V218), T205 (≠ P219), R228 (= R240)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
36% identity, 98% coverage: 6:320/320 of query aligns to 1:308/317 of 5v7gA
- active site: L94 (= L105), R228 (= R240), D252 (= D264), E257 (= E269), H275 (= H287)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ A81), V98 (≠ T109), F146 (≠ V157), L148 (≠ F159), G149 (= G160), R150 (= R161), I151 (= I162), T170 (= T180), R171 (≠ D181), V199 (= V213), P200 (= P214), S204 (≠ V218), T205 (≠ P219), V226 (≠ A238), G227 (≠ A239), R228 (= R240), H275 (= H287), A277 (= A289)
- binding oxalate ion: G69 (≠ S80), V70 (≠ A81), G71 (= G82), R228 (= R240), H275 (= H287)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 64:290/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 64:290/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L105), A100 (≠ T109), R149 (= R161), I150 (= I162), Y168 (≠ T180), D169 (= D181), P170 (≠ A185), I171 (≠ A186), H200 (= H212), T201 (≠ V213), P202 (= P214), T207 (≠ G217), C228 (≠ A238), A229 (= A239), R230 (= R240), H277 (= H287), G279 (≠ A289)
7dkmA Phgdh covalently linked to oridonin (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 66:292/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A81), A102 (≠ T109), G148 (= G158), R151 (= R161), I152 (= I162), Y170 (≠ T180), D171 (= D181), P172 (≠ A185), I173 (≠ A186), H202 (= H212), T203 (≠ V213), P204 (= P214), T209 (≠ G217), C230 (≠ A238), A231 (= A239), R232 (= R240), H279 (= H287), G281 (≠ A289)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 62:288/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G160), I148 (= I162), Y166 (≠ T180), D167 (= D181), P168 (≠ A185), I169 (≠ A186), I170 (≠ A187), H198 (= H212), T199 (≠ V213), L208 (= L220), R228 (= R240)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
36% identity, 71% coverage: 73:300/320 of query aligns to 70:296/533 of O43175
- T78 (≠ A81) binding
- R135 (≠ K137) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 161:162) binding
- D175 (= D181) binding
- T207 (≠ V213) binding
- CAR 234:236 (≠ AAR 238:240) binding
- D260 (= D264) binding
- V261 (= V265) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HMAS 287:290) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 65:291/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V157), G147 (= G158), L148 (≠ F159), G149 (= G160), R150 (= R161), I151 (= I162), G152 (= G163), D170 (= D181), H201 (= H212), T202 (≠ V213), P203 (= P214)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 65:291/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 65:291/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 65:291/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 66:292/305 of 6plfA
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 71% coverage: 73:300/320 of query aligns to 56:282/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (= R161), Y160 (≠ T180), D161 (= D181), P162 (≠ A185), I164 (≠ A187), L179 (= L199), T193 (≠ V213), P194 (= P214), S198 (≠ G216), L202 (= L220)
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
35% identity, 80% coverage: 63:319/320 of query aligns to 71:337/346 of 2w2lA
- active site: G113 (≠ L105), R257 (= R240), D281 (= D264), E286 (= E269), H304 (= H287)
- binding nicotinamide-adenine-dinucleotide: T117 (= T109), G172 (= G160), A173 (≠ R161), I174 (= I162), D194 (= D181), V228 (= V213), P229 (= P214), T234 (≠ P219), T255 (≠ A238), A256 (= A239), R257 (= R240), H304 (= H287), G306 (≠ A289), G307 (≠ S290)
Query Sequence
>BPHYT_RS20960 FitnessBrowser__BFirm:BPHYT_RS20960
MSENNRTRLLIARKVPTAVANRAEAEFHAFVTESDMDAWSVVDFCKKHATPAVLIGKKSG
LQAEHIAALPSTVKIIANASAGFDHMDVAAARERGIVVTNAPDALTECTADFSLLLVLAA
CRRASEYERIMRNGWGKSFGMTEMLGTRVNGKTLGIVGFGRIGRAVAKRAQGFGMRVIYT
DINRAAASLENGATFYNSLDEMLPHCQVLTLHVPGGGVPLMTKREFALLPAGAVFVNAAR
GALVDEDALYEALTSGHLFGAGLDVYRNEPNVDKRFAGLDNVFLTPHMASATMETRDQMG
FTALDNVAAVLNERPALNPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory