SitesBLAST
Comparing BPHYT_RS21000 FitnessBrowser__BFirm:BPHYT_RS21000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
36% identity, 75% coverage: 78:304/304 of query aligns to 96:312/314 of Q14894
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
36% identity, 74% coverage: 80:304/304 of query aligns to 97:311/312 of 2i99A
- active site: S228 (= S213)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R118 (= R101), T119 (= T102), G142 (= G125), A143 (≠ T126), G144 (= G127), V145 (≠ R128), Q146 (= Q129), N167 (≠ D152), R168 (≠ H153), T169 (≠ V154), V203 (≠ A188), T204 (= T189), L205 (≠ R190), A206 (≠ S191), V225 (≠ I210), G226 (= G211), S291 (= S284), L292 (= L285), G293 (= G286)
Sites not aligning to the query:
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
34% identity, 78% coverage: 67:304/304 of query aligns to 79:302/303 of 4bvaA
- active site: S219 (= S213)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T98), R109 (= R101), T110 (= T102), G135 (= G127), V136 (≠ R128), Q137 (= Q129), N158 (≠ D152), R159 (≠ H153), T160 (≠ V154), N163 (≠ T157), V194 (≠ A188), T195 (= T189), M196 (≠ R190), A197 (≠ S191), V216 (≠ I210), S282 (= S284), L283 (= L285), G284 (= G286)
- binding 3,5,3'triiodothyronine: S219 (= S213), R220 (≠ K214), W223 (≠ A217), E247 (= E242)
Sites not aligning to the query:
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
35% identity, 75% coverage: 78:304/304 of query aligns to 87:303/303 of 4bv9A
- active site: S220 (= S213)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T111 (= T102), G134 (= G125), G136 (= G127), V137 (≠ R128), Q138 (= Q129), N159 (≠ D152), R160 (≠ H153), T161 (≠ V154), V195 (≠ A188), T196 (= T189), M197 (≠ R190), A198 (≠ S191), V217 (≠ I210), G218 (= G211), S283 (= S284), L284 (= L285), G285 (= G286)
- binding pyruvic acid: R110 (= R101)
Sites not aligning to the query:
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
30% identity, 98% coverage: 4:301/304 of query aligns to 6:307/320 of 1omoA
- active site: R52 (≠ S50), D219 (≠ S213)
- binding nicotinamide-adenine-dinucleotide: T109 (= T102), G134 (= G127), T135 (≠ R128), Q136 (= Q129), Y156 (≠ I151), D157 (= D152), V158 (≠ H153), R159 (≠ V154), T195 (= T189), P196 (≠ R190), G217 (= G211), D219 (≠ S213), K223 (≠ A217), S290 (= S284), T291 (≠ L285), G292 (= G286)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
30% identity, 98% coverage: 4:301/304 of query aligns to 6:307/322 of O28608
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
25% identity, 98% coverage: 1:297/304 of query aligns to 1:309/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ D75), T111 (= T102), G136 (= G127), V137 (≠ R128), Q138 (= Q129), D159 (≠ G150), I160 (= I151), A199 (= A188), T200 (= T189), T201 (≠ R190), A202 (≠ S191), V206 (≠ L195), V221 (≠ I210), G222 (= G211), W223 (≠ S212), S296 (= S284), V297 (≠ L285), G298 (= G286)
- binding proline: R39 (≠ Q37), M54 (= M52), K67 (= K65), R110 (= R101)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
36% identity, 72% coverage: 78:295/304 of query aligns to 87:302/320 of A1B8Z0
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
36% identity, 72% coverage: 78:295/304 of query aligns to 89:304/322 of 6rqaB
- binding nicotinamide-adenine-dinucleotide: T113 (= T102), G138 (= G127), Q140 (= Q129), P162 (vs. gap), H163 (vs. gap), I199 (≠ A188), T200 (= T189), S201 (≠ R190), S202 (= S191), M221 (≠ I210), G222 (= G211), D224 (≠ S213), K228 (≠ A217), G293 (≠ S284), T294 (≠ L285), G295 (= G286)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
36% identity, 72% coverage: 78:295/304 of query aligns to 89:304/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: T113 (= T102), G138 (= G127), H139 (≠ R128), Q140 (= Q129), N161 (≠ G150), P162 (vs. gap), H163 (vs. gap), M166 (vs. gap), I199 (≠ A188), T200 (= T189), S201 (≠ R190), S202 (= S191), M221 (≠ I210), G222 (= G211), D224 (≠ S213), K228 (≠ A217), G293 (≠ S284)
Sites not aligning to the query:
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 72% coverage: 80:298/304 of query aligns to 93:317/325 of Q9FLY0
- G138 (= G125) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ V186) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
Sites not aligning to the query:
- 89 G→E: In sard4-3; compromises systemic acquired resistance (SAR).
5gziA Cyclodeaminase_pa
29% identity, 83% coverage: 41:291/304 of query aligns to 72:312/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ A54), T97 (≠ V66), R125 (= R101), T126 (= T102), G151 (= G127), A152 (≠ R128), Q153 (= Q129), D174 (≠ G150), T175 (≠ I151), H179 (≠ A155), A212 (= A188), T213 (= T189), S214 (≠ R190), V215 (≠ S191), V237 (≠ I210), G238 (= G211), A239 (≠ S212), S305 (= S284), T306 (≠ L285), G307 (= G286)
- binding (2S)-piperidine-2-carboxylic acid: K81 (≠ S50), R125 (= R101), A239 (≠ S212), T306 (≠ L285), G307 (= G286)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
29% identity, 83% coverage: 41:291/304 of query aligns to 68:308/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (≠ S50), R121 (= R101), T302 (≠ L285), G303 (= G286)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ A54), T93 (≠ V66), I94 (≠ Y67), R121 (= R101), T122 (= T102), G147 (= G127), A148 (≠ R128), Q149 (= Q129), D170 (≠ G150), T171 (≠ I151), H175 (≠ A155), A208 (= A188), T209 (= T189), S210 (≠ R190), V211 (≠ S191), V218 (≠ L195), V233 (≠ I210), A235 (≠ S212), S301 (= S284), T302 (≠ L285), G303 (= G286)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
29% identity, 83% coverage: 41:291/304 of query aligns to 68:308/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ A54), T93 (≠ V66), I94 (≠ Y67), T122 (= T102), G147 (= G127), A148 (≠ R128), Q149 (= Q129), D170 (≠ G150), T171 (≠ I151), A208 (= A188), T209 (= T189), S210 (≠ R190), V211 (≠ S191), V233 (≠ I210), A235 (≠ S212), S301 (= S284), T302 (≠ L285), G303 (= G286)
- binding proline: K77 (≠ S50), R121 (= R101)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
29% identity, 83% coverage: 41:291/304 of query aligns to 72:312/357 of 5gzlA
- binding lysine: D240 (≠ S213), R267 (≠ S241), E268 (= E242)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ A54), T97 (≠ V66), I98 (≠ Y67), T126 (= T102), G151 (= G127), A152 (≠ R128), Q153 (= Q129), D174 (≠ G150), T175 (≠ I151), H179 (≠ A155), A212 (= A188), T213 (= T189), S214 (≠ R190), V222 (≠ L195), V237 (≠ I210), G238 (= G211), A239 (≠ S212), D240 (≠ S213), K244 (≠ A217), S305 (= S284), T306 (≠ L285), G307 (= G286)
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
29% identity, 65% coverage: 98:294/304 of query aligns to 109:303/350 of Q88H32
Sites not aligning to the query:
- 45 binding
- 69 binding
- 84 binding
- 331 binding
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
29% identity, 65% coverage: 98:294/304 of query aligns to 108:302/341 of 1u7hA
- active site: D227 (≠ S213)
- binding nicotinamide-adenine-dinucleotide: R111 (= R101), T112 (= T102), G137 (= G127), A138 (≠ R128), Q139 (= Q129), D160 (≠ G150), T161 (≠ I151), V200 (= V186), T201 (= T187), A202 (= A188), I209 (≠ L195), V224 (≠ I210), G225 (= G211), D227 (≠ S213), K231 (≠ A217), S292 (= S284), V293 (≠ L285), G294 (= G286)
Sites not aligning to the query:
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
29% identity, 65% coverage: 98:294/304 of query aligns to 108:302/340 of 1x7dA
- active site: D227 (≠ S213)
- binding nicotinamide-adenine-dinucleotide: R111 (= R101), T112 (= T102), G137 (= G127), A138 (≠ R128), Q139 (= Q129), D160 (≠ G150), T161 (≠ I151), V200 (= V186), T201 (= T187), A202 (= A188), I209 (≠ L195), V224 (≠ I210), G225 (= G211), D227 (≠ S213), K231 (≠ A217), S292 (= S284), V293 (≠ L285), G294 (= G286)
- binding L-ornithine: R111 (= R101), D227 (≠ S213), V293 (≠ L285)
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
25% identity, 81% coverage: 17:263/304 of query aligns to 24:279/310 of 4m54A
- active site: I55 (≠ V49), M231 (≠ R218)
- binding N-[(2S)-2-amino-2-carboxyethyl]-L-glutamic acid: Y45 (≠ R39), R53 (≠ V47), M57 (= M51), K71 (= K65), I73 (≠ V66), R87 (= R73), R115 (= R101)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R87 (= R73), T116 (= T102), G141 (= G127), L142 (≠ R128), I143 (≠ Q129), D165 (≠ G150), Q166 (≠ I151), T207 (= T189), T209 (≠ S191), I228 (= I210)
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
24% identity, 74% coverage: 17:242/304 of query aligns to 24:260/334 of 4mp6A
- active site: I60 (≠ V49), M236 (≠ R218)
- binding nicotinamide-adenine-dinucleotide: R92 (= R73), R120 (= R101), T121 (= T102), G146 (= G127), L147 (≠ R128), I148 (≠ Q129), D170 (≠ G150), Q171 (≠ I151), C211 (≠ A188), T212 (= T189), V213 (≠ R190), I233 (= I210)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS21000 FitnessBrowser__BFirm:BPHYT_RS21000
MQFITDDHVRRLITMRDAIAELRIALAEHGAGRAPVQPRVRTKGEHVSVSMMGAILPSRG
VCGAKVYSTHGGRFDFVVPLFSSDDGCLISILHGDALTEFRTAAVTRIASDALARPGARV
LAVFGTGRQARAHIRALADGSSIERVLIVGIDHVAQTVAEMQALFPDKLIEASHAQAAAR
AADVIVTATRSATPLFDGTWVKPGVFIAAIGSSKPDARELDDALLARANTLVVESLEQAR
SEAGDLLMAAPGVVAWDDIIELGAVLANRRIEPRARGDVTIFKSLGFGLADVALAGLITR
RMSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory