SitesBLAST
Comparing BPHYT_RS21010 FitnessBrowser__BFirm:BPHYT_RS21010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 72% coverage: 99:397/415 of query aligns to 51:349/370 of 4yshA
- active site: Q52 (≠ R100), I262 (≠ V311), L283 (= L332), G305 (= G354), N335 (≠ L383), L338 (≠ T386)
- binding flavin-adenine dinucleotide: V178 (≠ I225), S206 (= S253), G207 (= G254), W209 (≠ G256), R307 (= R356), H332 (= H380), R334 (≠ A382), N335 (≠ L383), G336 (= G384), I337 (≠ F385)
Sites not aligning to the query:
- active site: 45, 48, 49
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 72% coverage: 99:397/415 of query aligns to 51:349/368 of 4yshB
- active site: Q52 (≠ R100), I262 (≠ V311), L283 (= L332), G305 (= G354), N335 (≠ L383), L338 (≠ T386)
- binding flavin-adenine dinucleotide: V178 (≠ I225), S206 (= S253), W209 (≠ G256), R307 (= R356), H332 (= H380), R334 (≠ A382), N335 (≠ L383), G336 (= G384), I337 (≠ F385), L338 (≠ T386)
- binding glycine: G249 (≠ V300), Y251 (= Y302), Y251 (= Y302), A264 (≠ G313), R307 (= R356), R334 (≠ A382), R334 (≠ A382)
Sites not aligning to the query:
- active site: 45, 48, 49
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
28% identity, 72% coverage: 99:397/415 of query aligns to 52:351/377 of Q5L2C2
- V180 (≠ I225) binding
- R309 (= R356) binding
- 334:340 (vs. 380:386, 29% identical) binding
- R336 (≠ A382) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
6j39A Crystal structure of cmis2 with inhibitor (see paper)
25% identity, 75% coverage: 104:415/415 of query aligns to 54:367/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ V291), Y252 (≠ V300), Y267 (≠ A315), R308 (= R356), R334 (≠ A382), I335 (≠ L383)
- binding flavin-adenine dinucleotide: A174 (≠ G216), A203 (≠ S253), W206 (≠ G256), I228 (≠ S277), Y252 (≠ V300), R308 (= R356), S333 (≠ G381), R334 (≠ A382), I335 (≠ L383), G336 (= G384), V337 (≠ F385), Q338 (≠ T386)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
25% identity, 75% coverage: 104:415/415 of query aligns to 54:367/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ G216), A203 (≠ S253), W206 (≠ G256), G226 (= G275), G306 (= G354), R308 (= R356), S333 (≠ G381), R334 (≠ A382), I335 (≠ L383), G336 (= G384), V337 (≠ F385), Q338 (≠ T386)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
19% identity, 98% coverage: 3:407/415 of query aligns to 4:352/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I6), G8 (= G7), G10 (= G9), V11 (= V10), I12 (= I11), V30 (≠ A29), E31 (≠ D30), K32 (≠ R31), E38 (= E38), A39 (≠ T39), S40 (= S40), A43 (≠ N43), G45 (= G45), L46 (≠ Q46), V171 (≠ I225), G200 (≠ S253), G201 (= G254), W203 (≠ G256), G298 (= G354), R300 (= R356), P301 (= P357), Y326 (≠ G381), R327 (≠ A382), N328 (≠ L383), G329 (= G384), I330 (≠ F385)
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
25% identity, 59% coverage: 169:411/415 of query aligns to 121:359/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P224), V174 (≠ I225), S202 (= S253), G203 (= G254), W205 (≠ G256), F209 (≠ L260), G300 (= G354), R302 (= R356), H327 (= H380), F328 (≠ G381), R329 (≠ A382), N330 (≠ L383), G331 (= G384), I332 (≠ F385)
- binding glycolic acid: Y246 (≠ T294), R302 (= R356), R329 (≠ A382)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 59% coverage: 169:411/415 of query aligns to 121:359/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ A382)
- binding flavin-adenine dinucleotide: V174 (≠ I225), S202 (= S253), G203 (= G254), W205 (≠ G256), F209 (≠ L260), G300 (= G354), R302 (= R356), H327 (= H380), R329 (≠ A382), N330 (≠ L383), G331 (= G384), I332 (≠ F385)
- binding phosphate ion: R254 (= R308)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 59% coverage: 169:411/415 of query aligns to 121:359/369 of O31616
- V174 (≠ I225) binding
- H244 (≠ R298) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R356) binding
- 327:333 (vs. 380:386, 29% identical) binding
- R329 (≠ A382) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
25% identity, 57% coverage: 168:402/415 of query aligns to 120:349/369 of S5FMM4
- S202 (= S253) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ F385) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L395) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
26% identity, 95% coverage: 1:396/415 of query aligns to 1:348/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G7), G9 (= G9), I10 (≠ V10), D30 (= D30), N32 (≠ H32), H33 (≠ Y49), K36 (≠ V52), A37 (= A53), T38 (≠ P54), A40 (= A56), G41 (= G57), A42 (≠ P58), G43 (= G59), V44 (= V60), Y174 (≠ P224), A203 (≠ S253), W206 (≠ G256), I210 (≠ L260), Y250 (≠ V300), G305 (= G354), R307 (= R356), G333 (= G381), A334 (= A382), S335 (≠ L383), G336 (= G384), L337 (≠ F385), T338 (= T386)
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
24% identity, 71% coverage: 121:414/415 of query aligns to 90:387/405 of P40875
- C146 (≠ E177) mutation to S: No change in activity.
- H173 (≠ C201) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ R203) mutation to A: No effect on FMN binding and activity.
- C195 (≠ T223) mutation to S: No change in activity.
- C351 (≠ V378) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
24% identity, 69% coverage: 130:414/415 of query aligns to 98:386/402 of 1vrqB
- active site: G326 (= G354), K358 (≠ T386)
- binding n,n-dimethylglycine: K358 (≠ T386)
- binding flavin-adenine dinucleotide: V196 (≠ I225), A224 (= A252), G225 (= G254), H228 (≠ A257), L247 (= L278), G353 (= G381), T354 (≠ A382), G355 (≠ L383), G356 (= G384), F357 (= F385), K358 (≠ T386)
- binding flavin mononucleotide: H172 (≠ C201), V251 (≠ L282), E279 (= E307), R322 (≠ G350), W324 (= W352)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
24% identity, 69% coverage: 130:414/415 of query aligns to 99:387/405 of Q50LF2
- K172 (≠ D200) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C201) modified: Tele-8alpha-FMN histidine
- V197 (≠ I225) binding
- H270 (≠ V300) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (= Y302) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G381) binding
- G357 (= G384) binding
- K359 (≠ T386) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
24% identity, 69% coverage: 130:414/415 of query aligns to 98:386/404 of 3ad8B
- active site: G326 (= G354), K358 (≠ T386)
- binding flavin-adenine dinucleotide: V196 (≠ I225), G225 (= G254), A226 (= A255), H228 (≠ A257), L247 (= L278), G353 (= G381), T354 (≠ A382), G355 (≠ L383), G356 (= G384), F357 (= F385), K358 (≠ T386)
- binding flavin mononucleotide: H172 (≠ C201), V251 (≠ L282), E279 (= E307), R322 (≠ G350), W324 (= W352)
- binding pyrrole-2-carboxylate: M264 (≠ D295), Y271 (= Y302), T354 (≠ A382), K358 (≠ T386)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
24% identity, 69% coverage: 130:414/415 of query aligns to 98:386/404 of 3ad7B
- active site: G326 (= G354), K358 (≠ T386)
- binding flavin-adenine dinucleotide: V196 (≠ I225), G225 (= G254), A226 (= A255), H228 (≠ A257), L247 (= L278), G353 (= G381), T354 (≠ A382), G355 (≠ L383), G356 (= G384), F357 (= F385), K358 (≠ T386)
- binding flavin mononucleotide: H172 (≠ C201), V251 (≠ L282), K277 (≠ L305), E279 (= E307), R322 (≠ G350), W324 (= W352)
- binding [methylthio]acetate: M264 (≠ D295), Y271 (= Y302), T354 (≠ A382), K358 (≠ T386)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
22% identity, 71% coverage: 121:414/415 of query aligns to 88:385/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (≠ I225), G224 (≠ S253), A225 (≠ G254), H227 (≠ G256), L231 (= L260), L246 (= L278), G352 (= G381), T353 (≠ A382), G354 (≠ L383), G355 (= G384), F356 (= F385), K357 (≠ T386)
- binding flavin mononucleotide: H171 (≠ C201), V250 (≠ L282), E278 (= E307), R321 (≠ G350), W323 (= W352)
- binding 2-furoic acid: M263 (≠ D295), Y270 (= Y302), K357 (≠ T386)
- binding sulfite ion: K170 (≠ D200), K276 (≠ L305)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62
- binding 2-furoic acid: 64, 66, 68, 401
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
47% identity, 10% coverage: 3:45/415 of query aligns to 6:48/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G7), G12 (= G9), I14 (= I11), E33 (≠ D30), K34 (≠ R31), E41 (= E38), T42 (= T39), S43 (= S40), A45 (≠ G42), N46 (= N43), S47 (≠ G44)
- binding sn-glycerol-3-phosphate: S47 (≠ G44)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 49, 51, 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 51, 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
47% identity, 10% coverage: 3:45/415 of query aligns to 6:48/384 of P75063
Sites not aligning to the query:
- 47:49 binding
- 177 binding
- 346:347 binding
- 352 binding
Query Sequence
>BPHYT_RS21010 FitnessBrowser__BFirm:BPHYT_RS21010
MRILIIGAGVIGLSSAYYLSRAGYDVTVADRHAEVASETSFGNGGQLSYSYVAPLAGPGV
VSKLPRWLTQRDSPVRFRPKLSVEQWRWCFEFLSACTRARSELTTQKLLSLSFLSRTLMH
ELIAAEPSLDFDFVRSGKLVLHRDANAMQSAVDLLAFQRTLGCEQQALSADACVEIEPAL
AHARSFLAGGIHTPSEDTADCRRFCKGLEAVLRERGVRFLMNTPIDGLKFGAKGVEAICD
GAPLAADRIVVASGAGAAQLLKPLGIRVAIYPIKGYSLTFDLQPHITAPHVSITDFARKV
VYARLGERLRVGGIADIGGYSLDADPARFATLRKETATLFPEVAQSAASGEWTGLRPATP
HGLPIVGPTRYPNLWLNVGHGALGFTLATGSAALLADGLAGSNNRELSSAFVLSH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory