SitesBLAST
Comparing BPHYT_RS21030 FitnessBrowser__BFirm:BPHYT_RS21030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 97% coverage: 1:497/513 of query aligns to 1:478/501 of P04983
- K43 (= K43) mutation to R: Loss of transport.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 48% coverage: 4:247/513 of query aligns to 2:237/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 48% coverage: 4:247/513 of query aligns to 3:238/371 of P68187
- A85 (≠ K89) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ Q110) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L117) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V120) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E122) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A129) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (≠ A147) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D168) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R237) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 48% coverage: 4:247/513 of query aligns to 2:237/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F14), S37 (≠ N39), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), Q81 (= Q86), R128 (= R139), A132 (≠ Q143), S134 (= S145), G136 (≠ A147), Q137 (≠ E148), E158 (= E169), H191 (= H201)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 48% coverage: 4:247/513 of query aligns to 2:237/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F14), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), R128 (= R139), S134 (= S145), Q137 (≠ E148)
- binding beryllium trifluoride ion: S37 (≠ N39), G38 (= G40), K41 (= K43), Q81 (= Q86), S134 (= S145), G136 (≠ A147), H191 (= H201)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 48% coverage: 4:247/513 of query aligns to 2:237/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F14), V17 (≠ A19), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), R128 (= R139), A132 (≠ Q143), S134 (= S145), Q137 (≠ E148)
- binding tetrafluoroaluminate ion: S37 (≠ N39), G38 (= G40), K41 (= K43), Q81 (= Q86), S134 (= S145), G135 (≠ V146), G136 (≠ A147), E158 (= E169), H191 (= H201)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 48% coverage: 4:247/513 of query aligns to 2:237/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F14), V17 (≠ A19), G38 (= G40), C39 (≠ A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), R128 (= R139), A132 (≠ Q143), S134 (= S145), Q137 (≠ E148)
- binding magnesium ion: S42 (= S44), Q81 (= Q86)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
29% identity, 47% coverage: 5:247/513 of query aligns to 1:235/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F14), S35 (≠ N39), G36 (= G40), C37 (≠ A41), G38 (= G42), K39 (= K43), S40 (= S44), T41 (= T45), R126 (= R139), A130 (≠ Q143), S132 (= S145), G134 (≠ A147), Q135 (≠ E148)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 48% coverage: 4:247/513 of query aligns to 3:238/369 of P19566
- L86 (= L90) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P170) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ T175) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 43% coverage: 9:230/513 of query aligns to 7:223/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 43% coverage: 10:230/513 of query aligns to 7:223/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F14), V16 (≠ A19), S36 (≠ N39), G37 (= G40), S38 (≠ A41), G39 (= G42), K40 (= K43), S41 (= S44), T42 (= T45), E162 (= E169), H194 (= H201)
- binding magnesium ion: S41 (= S44), E162 (= E169)
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 45% coverage: 5:235/513 of query aligns to 2:220/348 of 3d31A
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 39% coverage: 20:220/513 of query aligns to 25:222/233 of P75957
- G42 (= G37) mutation to D: Loss of lipoprotein release when overexpressed.
7mdyC Lolcde nucleotide-bound
31% identity, 39% coverage: 20:220/513 of query aligns to 22:219/226 of 7mdyC
- binding adp orthovanadate: G42 (= G40), S43 (≠ A41), G44 (= G42), K45 (= K43), S46 (= S44), T47 (= T45), Q91 (= Q86), H138 (≠ R139), E142 (≠ Q143), S144 (= S145), G145 (≠ V146), G146 (≠ A147), E168 (= E169), N172 (≠ V173), H201 (= H201)
- binding magnesium ion: S46 (= S44), Q91 (= Q86)
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 39% coverage: 20:220/513 of query aligns to 22:219/222 of 7arlD
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 46% coverage: 9:242/513 of query aligns to 9:254/254 of 1g6hA
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
30% identity, 39% coverage: 20:220/513 of query aligns to 24:221/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: S43 (≠ N39), G44 (= G40), G46 (= G42), K47 (= K43), S48 (= S44), T49 (= T45), Q93 (= Q86), R137 (≠ D136), H140 (≠ R139), E144 (≠ Q143), S146 (= S145), G148 (≠ A147), E149 (= E148), H203 (= H201)
- binding magnesium ion: S48 (= S44), Q93 (= Q86)
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 1:222/513 of query aligns to 1:222/648 of P75831
- K47 (= K43) mutation to L: Lack of activity.
- D169 (= D168) mutation to N: Lack of activity.
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
30% identity, 40% coverage: 27:233/513 of query aligns to 31:232/650 of 5ws4A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 44% coverage: 5:230/513 of query aligns to 1:225/242 of 3c4jA
Query Sequence
>BPHYT_RS21030 FitnessBrowser__BFirm:BPHYT_RS21030
MSMALELVGIHKSFDGFIALSDAQFDVRWGELHALLGENGAGKSTLMNVAAGLYAPETGT
ISVGGQPVRLSGPGDAARIGIGMVHQHFKLVSRFTVAENILLGISMGGAQPRYGKRLAKV
REAICSQCATLGFEIDPDRRISQLSVAEQQRVEILKVLLAGARILVLDEPTAVLTGQEAA
RLLETMRLLASKGSAVVLVTHKMADVRRYADRVTVMRSGRTVNTFRPSEMSQAEVVRLAV
GEVVAPEKPSIDAANRDRAEPRLLLRGVRSAASRTGTRQGLPALDGVDLTVHAGEIYGLA
GVGGNGQSELMQAIMGLLPLDEGTMVIEGAGDLRRASSVDRRDMGIACIPADRQTFALAG
LLSVVENFAIGQVHAGHYGNPLWLDYRRMEADAAKAVKHFDVLGVRSLRQSVSLLSGGNA
QKLVIAREFSRRPRVVLAHSPSRGLDVRASAQVHARLRAARDEGAAVLIISEDLDEVLAL
ADRAGVMVRGRIVGNFSAPVDRQAIGQAMVAHS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory