SitesBLAST
Comparing BPHYT_RS21090 FitnessBrowser__BFirm:BPHYT_RS21090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tukB Crystal structure of fdr9 (see paper)
36% identity, 95% coverage: 11:400/409 of query aligns to 3:381/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V15), G8 (= G16), G9 (= G17), G10 (= G18), A12 (= A20), A34 (= A42), E35 (= E43), R42 (= R50), P43 (= P51), K47 (= K55), A75 (≠ P87), A76 (= A88), T102 (= T114), G103 (= G115), V118 (≠ L133), R119 (≠ G134), G259 (= G281), D260 (= D282), H277 (≠ Q299), W278 (= W300), F311 (= F330), W312 (= W331)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
34% identity, 90% coverage: 12:379/409 of query aligns to 4:369/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G16), G10 (= G18), H11 (≠ L19), A12 (= A20), D34 (≠ A42), E35 (= E43), R42 (= R50), P43 (= P51), S46 (= S54), K47 (= K55), R78 (≠ H86), M79 (≠ P87), T106 (= T114), R127 (≠ G134), I153 (= I161), D275 (= D282), S292 (≠ Q299), V293 (≠ W300), W321 (= W331)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
30% identity, 90% coverage: 28:396/409 of query aligns to 22:391/409 of 3lxdA
- active site: R44 (= R50), P45 (= P51), N302 (≠ A304)
- binding flavin-adenine dinucleotide: R36 (≠ A42), E37 (= E43), R44 (= R50), P45 (= P51), S48 (= S54), K49 (= K55), E81 (≠ P87), V82 (≠ A88), T109 (= T114), I157 (= I161), G278 (= G281), D279 (= D282), S297 (≠ Q299), V298 (≠ W300), F325 (= F330), W326 (= W331)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 94% coverage: 12:394/409 of query aligns to 7:393/422 of P16640
- A15 (= A20) binding
- D37 (≠ A42) binding
- K50 (= K55) binding
- V83 (≠ A88) binding
- R134 (≠ G134) binding
- D284 (= D282) binding
- V302 (≠ W300) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
31% identity, 94% coverage: 12:394/409 of query aligns to 6:392/422 of 1q1wA
- active site: L13 (= L19), L44 (≠ R50), P45 (= P51), L305 (≠ A304)
- binding flavin-adenine dinucleotide: G10 (= G16), G12 (= G18), L13 (= L19), A14 (= A20), G35 (≠ T41), D36 (≠ A42), L44 (≠ R50), P45 (= P51), K49 (= K55), V82 (≠ A88), A108 (≠ C113), T109 (= T114), G110 (= G115), R133 (≠ G134), I159 (= I161), D283 (= D282), S300 (≠ Q299), V301 (≠ W300), W329 (= W331)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
34% identity, 91% coverage: 12:384/409 of query aligns to 6:370/402 of 2yvjA
- active site: L13 (= L19), R44 (= R50), P45 (= P51), Q291 (≠ A304)
- binding flavin-adenine dinucleotide: G10 (= G16), G12 (= G18), G35 (≠ T41), D36 (≠ A42), E37 (= E43), R44 (= R50), P45 (= P51), A78 (= A88), T105 (= T114), G106 (= G115), R126 (≠ G134), G268 (= G281), D269 (= D282), T286 (≠ Q299), W287 (= W300), A290 (= A303), W316 (= W331)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ L156), G148 (= G157), G149 (≠ A158), G150 (= G159), I152 (= I161), V170 (= V179), E171 (≠ N180), T172 (≠ L181), R179 (= R188), G230 (= G243), I231 (= I244), G232 (= G245), V233 (≠ S246), E285 (= E298)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
34% identity, 91% coverage: 12:384/409 of query aligns to 6:370/401 of 1f3pA
- active site: L13 (= L19), R44 (= R50), P45 (= P51), Q291 (≠ A304)
- binding flavin-adenine dinucleotide: A14 (= A20), V34 (= V40), D36 (≠ A42), E37 (= E43), R44 (= R50), P45 (= P51), A78 (= A88), T105 (= T114), G106 (= G115), R126 (≠ G134), G268 (= G281), D269 (= D282), E285 (= E298), T286 (≠ Q299), W287 (= W300), A290 (= A303), W316 (= W331)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ L156), G148 (= G157), G150 (= G159), V151 (≠ F160), I152 (= I161), E155 (= E164), E171 (≠ N180), T172 (≠ L181), R179 (= R188), G230 (= G243), I231 (= I244), G232 (= G245), V233 (≠ S246), E285 (= E298), W316 (= W331), S317 (= S332)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
34% identity, 91% coverage: 12:384/409 of query aligns to 5:369/401 of 2gr2A
- active site: L12 (= L19), R43 (= R50), P44 (= P51), Q290 (≠ A304)
- binding adenosine-5-diphosphoribose: R109 (= R119), V146 (≠ L156), G147 (= G157), G149 (= G159), V150 (≠ F160), I151 (= I161), E170 (≠ N180), T171 (≠ L181), R178 (= R188), G229 (= G243), I230 (= I244), G231 (= G245), E284 (= E298)
- binding flavin-adenine dinucleotide: G11 (= G18), A13 (= A20), D35 (≠ A42), E36 (= E43), R43 (= R50), P44 (= P51), K48 (= K55), A77 (= A88), T104 (= T114), G105 (= G115), R125 (≠ G134), G267 (= G281), D268 (= D282), T285 (≠ Q299), W286 (= W300), A289 (= A303), W315 (= W331)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
34% identity, 91% coverage: 12:384/409 of query aligns to 5:369/401 of 2gr0A
- active site: L12 (= L19), R43 (= R50), P44 (= P51), Q290 (≠ A304)
- binding adenosine-5'-diphosphate: V146 (≠ L156), G147 (= G157), G149 (= G159), I151 (= I161), E170 (≠ N180), T171 (≠ L181), R178 (= R188), G229 (= G243), I230 (= I244), G231 (= G245)
- binding flavin-adenine dinucleotide: G11 (= G18), A13 (= A20), D35 (≠ A42), E36 (= E43), R43 (= R50), P44 (= P51), K48 (= K55), T76 (≠ P87), A77 (= A88), T104 (= T114), G105 (= G115), R125 (≠ G134), I151 (= I161), G267 (= G281), D268 (= D282), E284 (= E298), T285 (≠ Q299), W286 (= W300), A289 (= A303), W315 (= W331)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
34% identity, 91% coverage: 12:384/409 of query aligns to 7:371/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G18), A15 (= A20), D37 (≠ A42), E38 (= E43), R45 (= R50), P46 (= P51), K50 (= K55), A79 (= A88), T106 (= T114), G107 (= G115), R127 (≠ G134), I153 (= I161), G269 (= G281), D270 (= D282), E286 (= E298), T287 (≠ Q299), W288 (= W300), A291 (= A303), W317 (= W331)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
34% identity, 91% coverage: 12:384/409 of query aligns to 6:370/401 of 4h4uA
- active site: L13 (= L19), R44 (= R50), P45 (= P51), Q291 (≠ A304)
- binding flavin-adenine dinucleotide: G12 (= G18), A14 (= A20), D36 (≠ A42), R44 (= R50), P45 (= P51), A78 (= A88), T105 (= T114), G106 (= G115), L125 (= L133), R126 (≠ G134), I152 (= I161), E155 (= E164), G268 (= G281), D269 (= D282), E285 (= E298), T286 (≠ Q299), W287 (= W300), A290 (= A303), W316 (= W331)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F160), I152 (= I161), E171 (≠ N180), R172 (≠ L181), Q173 (≠ A182), G230 (= G243), I231 (= I244), G232 (= G245), I284 (≠ C297), E285 (= E298), Y315 (≠ F330)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
34% identity, 91% coverage: 12:384/409 of query aligns to 5:369/399 of 4h4wA
- active site: L12 (= L19), R43 (= R50), P44 (= P51), Q290 (≠ A304)
- binding flavin-adenine dinucleotide: G11 (= G18), A13 (= A20), D35 (≠ A42), R43 (= R50), P44 (= P51), A77 (= A88), T104 (= T114), G105 (= G115), R125 (≠ G134), I151 (= I161), E154 (= E164), G267 (= G281), D268 (= D282), T285 (≠ Q299), W286 (= W300), A289 (= A303), W315 (= W331)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (≠ A158), I151 (= I161), R171 (≠ L181), S177 (≠ E187), R178 (= R188), G229 (= G243), I230 (= I244), G231 (= G245)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 94% coverage: 12:395/409 of query aligns to 5:384/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G18), V12 (≠ L19), G13 (≠ A20), D35 (≠ A42), E36 (= E43), R43 (= R50), P44 (= P51), S47 (= S54), K48 (= K55), V80 (≠ A88), T107 (= T114), G108 (= G115), R128 (≠ G134), G274 (= G281), D275 (= D282), T291 (≠ Q299), Y292 (≠ W300), S319 (≠ N328), W320 (= W331)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 94% coverage: 12:395/409 of query aligns to 4:383/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G18), V11 (≠ L19), G12 (≠ A20), D34 (≠ A42), E35 (= E43), R42 (= R50), P43 (= P51), K47 (= K55), E78 (≠ P87), V79 (≠ A88), T106 (= T114), G107 (= G115), G273 (= G281), D274 (= D282), T290 (≠ Q299), Y291 (≠ W300), W319 (= W331)
- binding nicotinamide-adenine-dinucleotide: R111 (= R119), G149 (= G157), L152 (≠ F160), I153 (= I161), E156 (= E164), E172 (≠ N180), A173 (≠ L181), R180 (= R188), V236 (≠ I244), G237 (= G245), A238 (≠ S246), E289 (= E298), W319 (= W331), T320 (≠ S332)
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 86% coverage: 26:376/409 of query aligns to 22:388/488 of Q9LK94
- G386 (= G374) mutation to Q: In sdp2-3; loss of ascorbate recycling.
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
31% identity, 75% coverage: 14:321/409 of query aligns to 5:314/424 of 8c0zE
Q9LFA3 Monodehydroascorbate reductase 1, peroxisomal; AtMDAR1; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 90% coverage: 9:376/409 of query aligns to 5:395/434 of Q9LFA3
Sites not aligning to the query:
- 432:434 mutation Missing: Loss of peroxisomal targeting.
5jclA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
25% identity, 86% coverage: 26:376/409 of query aligns to 21:393/429 of 5jclA
- active site: R45 (= R50), P46 (= P51), L61 (≠ D71), H65 (vs. gap), S70 (vs. gap), R317 (≠ A304)
- binding flavin-adenine dinucleotide: S36 (≠ T41), K37 (≠ A42), E38 (= E43), R45 (= R50), P46 (= P51), K50 (= K55), I93 (≠ A88), A119 (≠ C113), T120 (= T114), G121 (= G115), R144 (≠ G134), E145 (≠ R135), D295 (= D282), E311 (= E298), H312 (≠ Q299), V313 (≠ W300), A316 (= A303), Y346 (≠ W331)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G170 (= G159), Y171 (≠ F160), I172 (= I161), E175 (= E164), P192 (≠ L181), R199 (= R188), G256 (= G243), V257 (≠ I244), G258 (= G245), E311 (= E298), H312 (≠ Q299), Y346 (≠ W331)
Sites not aligning to the query:
Q652L6 Monodehydroascorbate reductase 3, cytosolic; OsMDAR3; OsMDHAR3; EC 1.6.5.4 from Oryza sativa subsp. japonica (Rice) (see paper)
24% identity, 86% coverage: 26:376/409 of query aligns to 24:396/435 of Q652L6
- E41 (= E43) binding
- R48 (= R50) binding
- K53 (= K55) binding
- C70 (vs. gap) mutation to A: No effect on catalytic activity.; mutation to S: Slight reduction of catalytic activity.
- G72 (vs. gap) mutation to N: Slight reduction of catalytic activity.
- I96 (≠ A88) binding
- RE 147:148 (≠ GR 134:135) binding
- 172:178 (vs. 158:164, 57% identical) binding
- YIGLE 174:178 (≠ FIGAE 160:164) binding
- E196 (≠ A182) binding ; mutation to A: Reduces catalytic activity 2-fold.
- R202 (= R188) binding ; binding
- G261 (= G245) binding ; binding
- D298 (= D282) binding
- EH 314:315 (≠ EQ 298:299) binding ; binding
- V316 (≠ W300) binding
- R320 (≠ A304) binding ; mutation to A: Reduces catalytic activity 5-fold.
- Y349 (≠ W331) binding ; binding ; binding ; mutation Y->A,F,W: Abolishes catalytic activity.
- R351 (≠ D333) binding ; mutation to A: No effect on catalytic activity.
Sites not aligning to the query:
5jciA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
24% identity, 86% coverage: 26:376/409 of query aligns to 21:393/432 of 5jciA
- active site: R45 (= R50), P46 (= P51), L61 (≠ D71), H65 (vs. gap), S70 (vs. gap), R317 (≠ A304)
- binding flavin-adenine dinucleotide: S36 (≠ T41), K37 (≠ A42), E38 (= E43), R45 (= R50), P46 (= P51), K50 (= K55), I93 (≠ A88), A119 (≠ C113), T120 (= T114), G121 (= G115), R144 (≠ G134), E145 (≠ R135), Y171 (≠ F160), I172 (= I161), L262 (≠ N249), D295 (= D282), H312 (≠ Q299), V313 (≠ W300), A316 (= A303), F345 (= F330), Y346 (≠ W331)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS21090 FitnessBrowser__BFirm:BPHYT_RS21090
MQNAIKSTSRRVAIVGGGLAALRCTEELRRGGHDGRIAIVTAEPHLPYDRPPLSKDVLLG
AKEFDEVQYRDDAFYRDHQVDMYLSHPATELRILEREVVANGSAIAFDDLLICTGASPRS
FPLKSNCDGIYTLGRIEDTLRLRAALRSGAPRVVILGAGFIGAEVASCARSLGLETTIVN
LAATPLERAVGPEMGGMLSALHADHGVRLLCSVSIAEIFGDGRVEELLLTNGERIACDIL
VIGIGSTPNIGWLEGSGLELANGIVCDAALSAGPPGIYAAGDVAWWPNGLFGRGMRCEQW
TNAAEQGRHVARNILAGHEGRTPFVGSNYFWSDQYGKRIQFAGSEVADEVKIVKGSYGEG
HFLAYYRKGDQLCGALALNEPKSLMLAKQQIEKRSRWDLALEAMGHCVP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory