SitesBLAST – Find functional sites

 

SitesBLAST

Comparing BPHYT_RS21420 FitnessBrowser__BFirm:BPHYT_RS21420 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 5 hits to proteins with known functional sites (download)

1o9lA Succinate:coenzyme-a transferase (pig heart)
46% identity, 94% coverage: 1:206/219 of query aligns to 245:451/468 of 1o9lA

query
sites
1o9lA
M
 
V
K
 
R
K
 
K
L
 
N
T
 
V
R
 
R
D
 
E
E
 
R
M
 
I
A
 
I
K
 
K
R
 
R
V
 
A
A
 
A
L
 
L
D
 
E
I
 
F
P
 
E
E
 
D
G
 
G
A
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
 
I
G
 
G
V
 
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
L
 
I
D
 
S
A
 
P
D
 
N
K
 
M
E
 
T
I
 
V
F
 
H
L
 
L
H
 
Q
S
 
S
E
 
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
M
 
L
G
 
G
P
 
P
A
 
Y
P
 
P
A
 
L
K
 
Q
G
 
N
E
 
E
E
 
V
D
 
D
D
 
A
E
 
D
L
 
L
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
E
H
 
T
V
 
V
T
 
T
L
 
V
L
 
L
T
 
P
G
 
G
G
 
A
C
 
S
Y
 
Y
F
 
F
H
 
S
H
 
S
A
 
D
D
 
E
S
 
S
F
 
F
A
 
A
M
 
M
M
 
I
R
 
R
G
 
G
G
 
G
H
 
H
L
 
V
D
 
N
F
 
L
C
 
T
V
 
M
L
 
L
G
 
G
A
 
A
F
 
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
W
H
 
M
T
 
I
G
 
P
A
 
G
P
 
-
D
 
K
A
 
L
I
 
V
P
 
K
A
 
G
V
 
M
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
A
 
V
I
 
S
G
 
S
A
 
A
K
 
K
-
 
T
Q
 
K
V
 
V
Y
 
V
V
 
V
M
 
T
M
 
M
E
 
E
H
 
H
L
 
S
T
 
A
K
 
K
Q
 
G
G
 
N
E
 
A
S
 
H
K
 
K
I
 
I
A
 
M
A
 
E
E
 
K
C
 
C
S
 
T
Y
 
L
P
 
P
V
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
C
 
C
V
 
V
D
 
N
R
 
R
I
 
I
Y
 
I
T
 
T
D
 
E
L
 
K
A
 
A
M
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
R
D
 
K
R
 
K
G
 
G
L
 
L
V
 
T
V
 
L
R
 
I
E
 
E
I
 
L
F
 
W
S
 
E
D
 
G
I
 
L
D
 
T
F
 
V
D
 
D
A
 
D
L
 
I
H
 
K
K
 
K
L
 
S
T
 
T
G
 
G

Sites not aligning to the query:

6lp1C Crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. (see paper)
48% identity, 92% coverage: 6:207/219 of query aligns to 254:454/469 of 6lp1C

query
sites
6lp1C
R
 
R
D
 
Q
E
 
R
M
 
I
A
 
A
K
 
R
R
 
R
V
 
A
A
 
A
L
 
L
D
 
E
I
 
F
P
 
A
E
 
N
G
 
G
A
 
M
Y
 
Y
V
 
V
N
 
N
L
 
L
G
 
G
I
 
I
G
 
G
V
 
I
P
 
P
T
 
T
L
 
E
V
 
S
A
 
S
N
 
N
H
 
Y
L
 
I
D
 
P
A
 
A
D
 
G
K
 
V
E
 
N
I
 
V
F
 
V
L
 
L
H
 
Q
S
 
S
E
 
E
N
 
N
G
 
G
L
 
L
L
 
I
G
 
G
M
 
M
G
 
G
P
 
P
A
 
F
P
 
P
A
 
T
K
 
E
G
 
D
E
 
K
E
 
V
D
 
D
D
 
A
E
 
D
L
 
W
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
Q
H
 
T
V
 
I
T
 
S
L
 
H
L
 
L
T
 
A
G
 
G
G
 
S
C
 
A
Y
 
L
F
 
F
H
 
D
H
 
S
A
 
A
D
 
T
S
 
S
F
 
F
A
 
A
M
 
M
M
 
I
R
 
R
G
 
G
G
 
G
H
 
H
L
 
M
D
 
D
F
 
L
C
 
T
V
 
M
L
 
L
G
 
G
A
 
A
F
 
L
Q
 
E
V
 
V
S
 
A
A
 
A
K
 
N
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
F
H
 
M
T
 
I
G
 
P
A
 
G
P
 
-
D
 
K
A
 
L
I
 
V
P
 
K
A
 
G
V
 
P
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
A
 
V
I
 
S
G
 
C
A
 
G
K
 
T
Q
 
R
V
 
V
Y
 
V
V
 
V
M
 
T
M
 
T
E
 
T
H
 
H
L
 
C
T
 
N
K
 
K
Q
 
N
G
 
G
E
 
D
S
 
P
K
 
K
I
 
I
A
 
V
A
 
E
E
 
R
C
 
C
S
 
R
Y
 
L
P
 
P
V
 
V
T
 
T
G
 
G
V
 
K
G
 
H
C
 
C
V
 
V
D
 
C
R
 
R
I
 
I
Y
 
I
T
 
T
D
 
E
L
 
Y
A
 
A
M
 
V
I
 
F
D
 
D
V
 
V
T
 
V
D
 
D
R
 
G
G
 
R
L
 
L
V
 
V
V
 
L
R
 
K
E
 
E
I
 
I
F
 
A
S
 
E
D
 
D
I
 
T
D
 
T
F
 
V
D
 
D
A
 
Q
L
 
V
H
 
K
K
 
K
L
 
L
T
 
T
G
 
G
V
 
V

Sites not aligning to the query:

Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
46% identity, 92% coverage: 6:206/219 of query aligns to 302:503/520 of Q29551

query
sites
Q29551
R
 
R
D
 
E
E
 
R
M
 
I
A
 
I
K
 
K
R
 
R
V
 
A
A
 
A
L
 
L
D
 
E
I
 
F
P
 
E
E
 
D
G
 
G
A
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
 
I
G
 
G
V
 
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
L
 
I
D
 
S
A
 
P
D
 
N
K
 
M
E
 
T
I
 
V
F
 
H
L
 
L
H
 
Q
S
 
S
E
|
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
M
 
L
G
 
G
P
 
P
A
 
Y
P
 
P
A
 
L
K
 
Q
G
 
N
E
 
E
E
 
V
D
 
D
D
 
A
E
 
D
L
 
L
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
E
H
 
T
V
 
V
T
 
T
L
 
V
L
 
L
T
 
P
G
 
G
G
 
A
C
 
S
Y
 
Y
F
 
F
H
 
S
H
 
S
A
 
D
D
 
E
S
 
S
F
 
F
A
 
A
M
 
M
M
 
I
R
 
R
G
 
G
G
 
G
H
 
H
L
 
V
D
 
N
F
 
L
C
 
T
V
 
M
L
 
L
G
 
G
A
 
A
F
 
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
W
H
 
M
T
 
I
G
 
P
A
 
G
P
 
-
D
 
K
A
 
L
I
 
V
P
 
K
A
 
G
V
 
M
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
A
 
V
I
 
S
G
 
S
A
 
A
K
 
K
-
 
T
Q
 
K
V
 
V
Y
 
V
V
 
V
M
 
T
M
 
M
E
 
E
H
 
H
L
 
S
T
 
A
K
 
K
Q
 
G
G
 
N
E
 
A
S
 
H
K
 
K
I
 
I
A
 
M
A
 
E
E
 
K
C
 
C
S
 
T
Y
 
L
P
 
P
V
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
C
 
C
V
 
V
D
 
N
R
 
R
I
 
I
Y
 
I
T
 
T
D
 
E
L
 
K
A
 
A
M
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
S
D
 
K
R
 
K
G
 
G
L
 
L
V
 
T
V
 
L
R
 
I
E
 
E
I
 
L
F
 
W
S
 
E
D
 
G
I
 
L
D
 
T
F
 
V
D
 
D
A
 
D
L
 
I
H
 
K
K
 
K
L
 
S
T
 
T
G
 
G

Sites not aligning to the query:

3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
46% identity, 92% coverage: 6:206/219 of query aligns to 249:450/466 of 3k6mC

query
sites
3k6mC
R
 
R
D
 
E
E
 
R
M
 
I
A
 
I
K
 
K
R
 
R
V
 
A
A
 
A
L
 
L
D
 
E
I
 
F
P
 
E
E
 
D
G
 
G
A
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
|
I
G
 
G
V
 
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
L
 
I
D
 
S
A
 
P
D
 
N
K
 
M
E
 
T
I
 
V
F
 
H
L
 
L
H
 
Q
S
 
S
E
|
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
M
 
L
G
 
G
P
 
P
A
 
Y
P
 
P
A
 
L
K
 
Q
G
 
N
E
 
E
E
 
V
D
 
D
D
 
A
E
 
D
L
 
L
I
 
I
N
 
N
A
|
A
G
 
G
K
 
K
Q
 
E
H
 
T
V
 
V
T
 
T
L
 
V
L
 
L
T
 
P
G
 
G
G
 
A
C
 
S
Y
 
Y
F
 
F
H
 
S
H
 
S
A
 
D
D
 
E
S
 
S
F
 
F
A
 
A
M
 
M
M
 
I
R
 
R
G
 
G
G
 
G
H
 
H
L
 
V
D
 
N
F
 
L
C
 
T
V
 
M
L
 
L
G
 
G
A
 
A
F
 
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
W
H
 
M
T
 
I
G
 
P
A
 
G
P
 
-
D
 
K
A
 
L
I
 
V
P
 
K
A
 
G
V
 
M
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
A
x
V
I
 
S
G
 
S
A
|
A
K
 
K
-
x
T
Q
 
K
V
 
V
Y
 
V
V
 
V
M
 
T
M
 
M
E
 
E
H
 
H
L
 
S
T
 
A
K
 
K
Q
 
G
G
 
N
E
 
A
S
 
H
K
 
K
I
 
I
A
 
M
A
 
E
E
 
K
C
 
C
S
 
T
Y
 
L
P
 
P
V
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
C
|
C
V
 
V
D
x
N
R
 
R
I
 
I
Y
 
I
T
 
T
D
 
E
L
 
K
A
 
A
M
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
R
D
 
K
R
 
K
G
 
G
L
 
L
V
 
T
V
 
L
R
 
I
E
 
E
I
 
L
F
 
W
S
 
E
D
 
G
I
 
L
D
 
T
F
 
V
D
 
D
A
 
D
L
 
I
H
 
K
K
 
K
L
 
S
T
 
T
G
 
G

Sites not aligning to the query:

3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
45% identity, 94% coverage: 1:206/219 of query aligns to 240:446/462 of 3oxoE

query
sites
3oxoE
M
 
I
K
 
E
K
 
R
L
 
L
T
 
S
R
 
V
D
 
R
E
 
R
M
 
I
A
 
I
K
 
K
R
 
R
V
 
A
A
 
A
L
 
L
D
 
E
I
 
F
P
 
E
E
 
D
G
 
G
A
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
|
I
G
|
G
V
x
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
L
 
I
D
 
S
A
 
P
D
 
N
K
 
M
E
 
T
I
 
V
F
 
H
L
 
L
H
 
Q
S
 
S
E
|
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
M
 
L
G
 
G
P
 
P
A
 
Y
P
 
P
A
 
L
K
 
Q
G
 
N
E
 
E
E
 
V
D
 
D
D
 
A
E
 
D
L
 
L
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
E
H
 
T
V
 
V
T
 
T
L
 
V
L
 
L
T
 
P
G
 
G
G
 
A
C
 
S
Y
 
Y
F
 
F
H
 
S
H
 
S
A
 
D
D
 
E
S
 
S
F
 
F
A
 
A
M
 
M
M
 
I
R
 
R
G
 
G
G
 
G
H
 
H
L
 
V
D
 
N
F
 
L
C
 
T
V
 
M
L
 
L
G
|
G
A
 
A
F
x
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
|
N
W
 
W
H
 
M
T
x
I
G
 
P
A
 
G
P
 
-
D
 
K
A
 
L
I
 
V
P
 
K
A
 
G
V
x
M
G
 
G
G
 
G
A
|
A
M
 
M
D
 
D
L
 
L
A
 
V
I
 
S
G
 
S
A
 
A
K
 
K
-
 
T
Q
 
K
V
 
V
Y
 
V
V
 
V
M
 
T
M
 
M
E
 
E
H
 
H
L
 
S
T
 
A
K
|
K
Q
 
G
G
 
N
E
 
A
S
 
H
K
 
K
I
 
I
A
 
M
A
 
E
E
 
K
C
 
C
S
 
T
Y
 
L
P
 
P
V
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
C
 
C
V
 
V
D
 
N
R
 
R
I
 
I
Y
 
I
T
 
T
D
 
E
L
 
K
A
 
A
M
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
R
D
 
K
R
 
K
G
 
G
L
 
L
V
 
T
V
 
L
R
 
I
E
 
E
I
 
L
F
 
W
S
 
E
D
 
G
I
 
L
D
 
T
F
 
V
D
 
D
A
 
D
L
 
I
H
 
K
K
 
K
L
 
S
T
 
T
G
 
G

Query Sequence

>BPHYT_RS21420 FitnessBrowser__BFirm:BPHYT_RS21420
MKKLTRDEMAKRVALDIPEGAYVNLGIGVPTLVANHLDADKEIFLHSENGLLGMGPAPAK
GEEDDELINAGKQHVTLLTGGCYFHHADSFAMMRGGHLDFCVLGAFQVSAKGDLANWHTG
APDAIPAVGGAMDLAIGAKQVYVMMEHLTKQGESKIAAECSYPVTGVGCVDRIYTDLAMI
DVTDRGLVVREIFSDIDFDALHKLTGVPLIDGTQAAHAA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory