Comparing BPHYT_RS21430 FitnessBrowser__BFirm:BPHYT_RS21430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
93% identity, 99% coverage: 1:261/263 of query aligns to 1:261/261 of 2xuaH
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 89% coverage: 26:259/263 of query aligns to 28:267/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 89% coverage: 26:259/263 of query aligns to 28:267/278 of 4uhfA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 89% coverage: 26:259/263 of query aligns to 28:267/272 of 4uheA
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 100% coverage: 1:262/263 of query aligns to 1:266/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 100% coverage: 1:262/263 of query aligns to 1:263/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 100% coverage: 1:262/263 of query aligns to 1:260/262 of 6eb3C
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
25% identity, 97% coverage: 5:259/263 of query aligns to 8:253/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
25% identity, 97% coverage: 5:259/263 of query aligns to 8:253/254 of 2ocgA
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
25% identity, 97% coverage: 5:259/263 of query aligns to 45:290/291 of Q86WA6
Sites not aligning to the query:
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 42:270/271 of 2d0dA
Sites not aligning to the query:
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 43:271/276 of 1iunB
Sites not aligning to the query:
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 42:270/271 of 1ukaA
Sites not aligning to the query:
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 42:270/271 of 1uk9A
Sites not aligning to the query:
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 42:270/271 of 1uk8A
Sites not aligning to the query:
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 42:270/271 of 1uk7A
Sites not aligning to the query:
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
27% identity, 85% coverage: 39:261/263 of query aligns to 42:270/271 of 1iupA
Sites not aligning to the query:
5z7wB Crystal structure of striga hermonthica htl1 (shhtl1) (see paper)
22% identity, 90% coverage: 21:256/263 of query aligns to 16:263/271 of 5z7wB
8agsAAA Alpha/beta epoxide hydrolase
23% identity, 98% coverage: 3:259/263 of query aligns to 8:287/298 of 8agsAAA
8agpAAA Alpha/beta epoxide hydrolase
23% identity, 98% coverage: 3:259/263 of query aligns to 7:286/297 of 8agpAAA
>BPHYT_RS21430 FitnessBrowser__BFirm:BPHYT_RS21430
MPYAAVNGTELHYRIDGDRHGNAPWIVLSNSLGTDLSMWASQVAALSKHFRVLRYDTRGH
GHSEAPKGPYTIEQLTGDVLGLMDTLKIARANFCGISMGGLTGVALAARHGNRFERVVLC
NTAARIGSPEVWVPRAAKARSEGMLALADAVLPRWFTADYIEREPVVLALIRDVFVHTDK
EGYASNCDAIDAADLRPEAPGIKLPALVISGTHDLAATPAQGRELAQSIPGARYVELDAS
HISNIEKADAFTKTVVDFLTEQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory