Comparing BPHYT_RS21495 FitnessBrowser__BFirm:BPHYT_RS21495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 91% coverage: 1:244/269 of query aligns to 2:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 91% coverage: 1:244/269 of query aligns to 2:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 90% coverage: 2:244/269 of query aligns to 1:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 90% coverage: 4:244/269 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 90% coverage: 4:244/269 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 90% coverage: 4:244/269 of query aligns to 3:235/238 of 6s8gA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 84% coverage: 2:227/269 of query aligns to 3:218/285 of 4yerA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 90% coverage: 4:244/269 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 89% coverage: 4:243/269 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 89% coverage: 4:243/269 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 89% coverage: 4:242/269 of query aligns to 3:233/233 of 6b8bA
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 93% coverage: 1:249/269 of query aligns to 1:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 93% coverage: 1:249/269 of query aligns to 1:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 93% coverage: 1:249/269 of query aligns to 1:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 93% coverage: 1:249/269 of query aligns to 1:242/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 87% coverage: 3:235/269 of query aligns to 4:230/280 of 5x40A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 87% coverage: 3:237/269 of query aligns to 2:228/241 of 4u00A
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 91% coverage: 2:247/269 of query aligns to 1:243/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 91% coverage: 2:247/269 of query aligns to 3:245/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 91% coverage: 2:247/269 of query aligns to 3:245/263 of 7d08B
>BPHYT_RS21495 FitnessBrowser__BFirm:BPHYT_RS21495
MSLLRVSGLCKSFGGLKAVDDVSFDLEAGQLLALLGPNGAGKSTCFNMVNGQLPPSSGSI
RLDGQELVGMRPRDIWRLGVGRTFQIAATFNSMTVIENVQMALVSRERKTFGLWKPAGAR
YADEALALLDQVGMASDAHRACGVLAYGDVKRVELAIALANRPKLLLMDEPTAGMAPKER
NELMALTKRLVTEHKIGVLFTEHSMDVVFAYADRLIVLARGKLIAEGDADTIRNDPRVQE
VYFGTGKTFQPHAPLHDAAGGHQGQGALQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory