Comparing BPHYT_RS21925 FitnessBrowser__BFirm:BPHYT_RS21925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
28% identity, 87% coverage: 44:320/320 of query aligns to 21:291/298 of 4mynA
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
24% identity, 83% coverage: 55:320/320 of query aligns to 49:313/321 of 3m1rD
6dktE Crystal structure of arginase from bacillus subtilis
26% identity, 87% coverage: 42:320/320 of query aligns to 2:263/268 of 6dktE
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
25% identity, 86% coverage: 44:319/320 of query aligns to 8:267/276 of 3lhlA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
27% identity, 82% coverage: 60:320/320 of query aligns to 51:307/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
27% identity, 82% coverage: 60:320/320 of query aligns to 48:304/315 of 3niqA
6dktA Crystal structure of arginase from bacillus subtilis
25% identity, 87% coverage: 42:320/320 of query aligns to 2:278/283 of 6dktA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
27% identity, 82% coverage: 60:320/320 of query aligns to 49:305/316 of 3nipB
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
26% identity, 82% coverage: 60:320/320 of query aligns to 37:280/284 of Q57757
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
25% identity, 87% coverage: 42:320/320 of query aligns to 5:284/289 of 6nfpD
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
25% identity, 87% coverage: 42:320/320 of query aligns to 2:287/292 of 6nfpA
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
25% identity, 68% coverage: 102:320/320 of query aligns to 73:293/298 of 5cevA
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
25% identity, 68% coverage: 102:320/320 of query aligns to 73:293/298 of 4cevA
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
25% identity, 68% coverage: 102:320/320 of query aligns to 73:293/298 of 3cevA
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
25% identity, 68% coverage: 102:320/320 of query aligns to 73:293/298 of 2cevB
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
25% identity, 68% coverage: 102:320/320 of query aligns to 74:294/299 of 1cevA
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
25% identity, 68% coverage: 102:320/320 of query aligns to 74:294/299 of P53608
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
28% identity, 81% coverage: 62:319/320 of query aligns to 59:314/320 of 6vstD
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
28% identity, 81% coverage: 62:319/320 of query aligns to 56:311/317 of 6vstA
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
24% identity, 80% coverage: 60:315/320 of query aligns to 39:278/293 of 3pzlB
>BPHYT_RS21925 FitnessBrowser__BFirm:BPHYT_RS21925
MRVPFDDKMWAGRSDDGEPGDTRRVFNQIVPFDGSLRAHGDTTVVVGFGSDEGVRRNQGR
TGAAHAPKELRRALAGLPAKNSMAMLADAGDVACDDGDLEGAQAELANVISEVLASGGRP
LVFGGGHEVAWATYCGLVLHQHRREADESATPRKLLIINFDAHFDLRQKRPANSGTPFDQ
IANDCAERRVPFNYVCFGISDLGNTASLFVHAQRLGVRYALDVDMQETQLPLRLQELDLM
LDEADDVYLTIDLDVLPAATAPGVSAPAALGVPLFVVEEMVRRVRGSGKLRAADIAEYNP
SLDQDRRTARAAARLAYRLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory