Comparing BPHYT_RS22035 FitnessBrowser__BFirm:BPHYT_RS22035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
41% identity, 91% coverage: 3:304/332 of query aligns to 4:303/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
41% identity, 91% coverage: 3:304/332 of query aligns to 3:292/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 98% coverage: 1:324/332 of query aligns to 1:326/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 77% coverage: 2:257/332 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 77% coverage: 2:257/332 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 77% coverage: 2:257/332 of query aligns to 2:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 89% coverage: 21:317/332 of query aligns to 18:308/343 of P30750
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 89% coverage: 21:317/332 of query aligns to 19:309/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 89% coverage: 21:317/332 of query aligns to 19:309/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 89% coverage: 21:317/332 of query aligns to 19:309/344 of 3tuiC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 77% coverage: 2:255/332 of query aligns to 1:237/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 75% coverage: 9:257/332 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 75% coverage: 9:257/332 of query aligns to 4:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 75% coverage: 9:257/332 of query aligns to 4:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 75% coverage: 9:257/332 of query aligns to 4:241/242 of 2oljA
7arlD Lolcde in complex with lipoprotein and adp (see paper)
38% identity, 64% coverage: 3:214/332 of query aligns to 2:203/222 of 7arlD
7mdyC Lolcde nucleotide-bound
38% identity, 64% coverage: 3:214/332 of query aligns to 2:203/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 64% coverage: 3:214/332 of query aligns to 5:206/233 of P75957
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
36% identity, 65% coverage: 2:218/332 of query aligns to 3:208/648 of P75831
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
37% identity, 64% coverage: 3:214/332 of query aligns to 4:205/229 of 7v8iD
>BPHYT_RS22035 FitnessBrowser__BFirm:BPHYT_RS22035
MPLLEVKDLSVRFTRREGAPVDAVQGVSFSLEAGRTLGIVGESGSGKSQTVMALLGLLAG
NGKVSGSATYRGENLLTMNEASLNKIRGDRIGMIFQDPMTSLNPFLTIERQMTETLQLHR
KMSRREARRRAIETLESVRIPDAARRIGMYPHEFSGGMRQRVMIAMALLSEPEILIADEP
TTALDVTVQAQIIELLRELNRERGTAIILITHDMGVVAGLCDDVMVMYAGQTVEQASAAA
LFAAPTHPYTLGLLNALPRLTDDDDDRPLQTIPGNPPLPGEVGAGCAFAPRCGYCTERCR
ESRPPLAASADHVDALRACHRPVGEILEAQHV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory