Comparing BPHYT_RS22525 FitnessBrowser__BFirm:BPHYT_RS22525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
44% identity, 83% coverage: 42:273/279 of query aligns to 2:230/235 of 3tqwA
4yahX Crystal structure of the methionine binding protein, metq (see paper)
40% identity, 87% coverage: 38:279/279 of query aligns to 1:243/245 of 4yahX
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
42% identity, 83% coverage: 41:271/279 of query aligns to 1:233/241 of 4qhqA
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
39% identity, 88% coverage: 35:279/279 of query aligns to 27:272/272 of P04846
Sites not aligning to the query:
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
38% identity, 82% coverage: 38:266/279 of query aligns to 4:232/237 of 3k2dA
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
34% identity, 71% coverage: 55:251/279 of query aligns to 17:215/242 of 4ntlA
Sites not aligning to the query:
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
43% identity, 58% coverage: 44:205/279 of query aligns to 11:167/240 of 6dzxA
Sites not aligning to the query:
3gxaC Crystal structure of gna1946 (see paper)
45% identity, 52% coverage: 61:205/279 of query aligns to 23:168/244 of 3gxaC
Sites not aligning to the query:
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
36% identity, 78% coverage: 63:279/279 of query aligns to 36:260/260 of 6jf1A
Sites not aligning to the query:
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
37% identity, 58% coverage: 35:197/279 of query aligns to 1:163/247 of 4ib2A
Sites not aligning to the query:
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
41% identity, 74% coverage: 62:267/279 of query aligns to 21:229/255 of 1p99A
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
29% identity, 77% coverage: 41:254/279 of query aligns to 4:216/240 of 1xs5A
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
34% identity, 77% coverage: 38:251/279 of query aligns to 2:213/240 of 4oteB
>BPHYT_RS22525 FitnessBrowser__BFirm:BPHYT_RS22525
MRIFLSTVQRFFHTPAVSLISAFGLALVLQATPASAADSPTLKIGTATSPQIEALKIAAR
EAKEQGLDVKIIEFTDWNTPNAALANKDIDVNYFQHIPFLENAKKQGGYNFVAIAPGTIM
KIGLYSKKIKRFDELKDGATVAIANDPVNGGRGLLLLQRAGLIKLKPGIDYRATTLDIID
NPKHLKIVQLEASQLARSLDDVDLAQGYPSFIKLAGTTDPNSALLFDGLENKNYAIQWVV
RPESANDPRIRKFIAIYQHSPAVRAALDKAFGNLYAVAW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory