Comparing BPHYT_RS22635 FitnessBrowser__BFirm:BPHYT_RS22635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
33% identity, 90% coverage: 6:276/301 of query aligns to 4:272/291 of 3na8A
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
27% identity, 96% coverage: 3:291/301 of query aligns to 1:290/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
27% identity, 96% coverage: 4:291/301 of query aligns to 1:289/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
27% identity, 96% coverage: 4:291/301 of query aligns to 1:289/292 of P0A6L2
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
27% identity, 96% coverage: 4:291/301 of query aligns to 1:289/292 of 3i7sA
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 93% coverage: 4:283/301 of query aligns to 2:286/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
29% identity, 93% coverage: 4:283/301 of query aligns to 2:286/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 93% coverage: 4:283/301 of query aligns to 2:286/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 93% coverage: 4:283/301 of query aligns to 2:286/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 93% coverage: 4:283/301 of query aligns to 2:286/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
29% identity, 93% coverage: 4:283/301 of query aligns to 2:286/298 of 3nevA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 92% coverage: 6:282/301 of query aligns to 3:279/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 92% coverage: 6:282/301 of query aligns to 3:279/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 92% coverage: 6:282/301 of query aligns to 3:279/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 92% coverage: 6:282/301 of query aligns to 3:279/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 92% coverage: 6:282/301 of query aligns to 3:279/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 92% coverage: 6:282/301 of query aligns to 3:279/291 of 3pueB
4pfmA Shewanella benthica dhdps with lysine and pyruvate
29% identity, 68% coverage: 3:207/301 of query aligns to 1:205/295 of 4pfmA
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
26% identity, 98% coverage: 1:295/301 of query aligns to 2:297/297 of 8u8wA
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
28% identity, 92% coverage: 8:284/301 of query aligns to 10:286/307 of 4fhaA
>BPHYT_RS22635 FitnessBrowser__BFirm:BPHYT_RS22635
MAHIWEGVLPAVTTKFNADFSIDRAWTGKNIEAQIDAGVDGIIVCGSLGEASTLSLDEKL
QVLDIAVEASRGRVPVLLTIAENSTLDACRQAEAGSRHGAAGYMVLPGLRYLSDRRETLH
HFRSVADASALPLMIYNNPLAYGVDMTPDMFAEIADEKKIVAIKESCGDVRRVTDLINVV
GDRFAILCGVDNLAMEAILMGAHGWVAGLVCAFPRETVAIYKLLKAGRIEEARAIYRWFA
PLLALDVSAKLVQNIKLAEAIVGLGTEPVRPPRLPLAGDERKAVEALIRKSLETRPALPQ
I
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory