Comparing BPHYT_RS22675 FitnessBrowser__BFirm:BPHYT_RS22675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
58% identity, 100% coverage: 1:626/627 of query aligns to 1:626/635 of Q88JU3
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
58% identity, 100% coverage: 1:626/627 of query aligns to 3:623/624 of 5hmqD
7xntA Crystal structure of pfhppd-y13161 complex
31% identity, 53% coverage: 281:614/627 of query aligns to 2:329/341 of 7xntA
Sites not aligning to the query:
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
31% identity, 52% coverage: 292:614/627 of query aligns to 8:333/352 of 1cjxA
Sites not aligning to the query:
7x8eA Crystal structure of pfhppd-y13287 complex
31% identity, 53% coverage: 281:614/627 of query aligns to 1:325/341 of 7x8eA
Sites not aligning to the query:
7xntC Crystal structure of pfhppd-y13161 complex
31% identity, 53% coverage: 281:614/627 of query aligns to 1:313/320 of 7xntC
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 50% coverage: 311:625/627 of query aligns to 23:334/335 of 7yvvA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
28% identity, 48% coverage: 312:614/627 of query aligns to 23:334/357 of O52791
2r5vA Hydroxymandelate synthase crystal structure (see paper)
27% identity, 48% coverage: 312:614/627 of query aligns to 22:332/346 of 2r5vA
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
26% identity, 41% coverage: 355:614/627 of query aligns to 80:348/362 of 1t47A
Sites not aligning to the query:
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
24% identity, 54% coverage: 289:627/627 of query aligns to 3:341/343 of 3zgjB
5yy6A Crystal structure of arabidopsis thaliana hppd truncated mutant complexed with benquitrione (see paper)
29% identity, 41% coverage: 349:605/627 of query aligns to 94:346/371 of 5yy6A
Sites not aligning to the query:
5ywkA Crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl (see paper)
29% identity, 41% coverage: 349:605/627 of query aligns to 93:346/372 of 5ywkA
Sites not aligning to the query:
6m6dA Structure of hppd complexed with a synthesized inhibitor (see paper)
29% identity, 41% coverage: 349:605/627 of query aligns to 94:350/382 of 6m6dA
Sites not aligning to the query:
8hzuA Crystal structure of athppd-xhd complex
29% identity, 41% coverage: 349:605/627 of query aligns to 94:348/377 of 8hzuA
Sites not aligning to the query:
7x6mA Crystal structure of athppd-y191058 complex
29% identity, 41% coverage: 349:605/627 of query aligns to 94:348/377 of 7x6mA
Sites not aligning to the query:
7x5uA Crystal structure of athppd-diketonitrile complex
29% identity, 41% coverage: 349:605/627 of query aligns to 94:348/377 of 7x5uA
Sites not aligning to the query:
8i2pA Crystal structure of athppd-y19060 complex
29% identity, 41% coverage: 349:605/627 of query aligns to 94:350/379 of 8i2pA
Sites not aligning to the query:
8hz6A Crystal structure of athppd-qry2089 complex
29% identity, 41% coverage: 349:605/627 of query aligns to 94:348/377 of 8hz6A
Sites not aligning to the query:
1tg5A Crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645 (see paper)
29% identity, 41% coverage: 349:607/627 of query aligns to 94:351/371 of 1tg5A
Sites not aligning to the query:
>BPHYT_RS22675 FitnessBrowser__BFirm:BPHYT_RS22675
MQRSIATVSISGTLVEKLTAIQAAGFEGVEIFENDLLYFDGSPADVRRIAEDLGLKIMLF
QPFRDFDGVSPERLERNLDRAKRKFDVMHELGTDRILVCSNVSPDTIGDDALMTDQLGAL
ARAAEAAGVIAGYEALAWGKHVKTYRHAWKLVNTVNHPNLGLVLDSFHTLSLNDTPDAIA
DIPGGRIAFVQIADAPKLAMDVLEWSRHYRCFPGQGDFDLANFTAQVVKTGYSGPLSLEI
FNDGFRAAPTTITAADGHRSLLFLEEQTRALLESTQQPVGDLYRSPAAPAHVGYQFLEFA
VDHSTRAQLVDWLGKLRFREAGRHRSKEVTLYQHGAASIVLNAEPDSFANAFFQQHGLSL
CASAFRVDDANQAFERAAGFGYAPFSGQIGPNERVLPAVQAPDSSLNYFVDETPDQPTLF
EADFVLTDINGPSEVGPLSRIDHVCLSVPANSLDTWVLFLRTALGFQAEPGVLVPDPYGL
VRSRALRSHDGSVRIVLNASVDHHTAVAEALHTYHGSGLNHVAFSTSDIFSAIPEFVADG
LPVLRIPRNYYEDLAARYALPDGTLEALRANNILYDRDERGGEFFHAYTEQLDQRFFMEI
VERRGGYDGYGAANAAVRLAAQAQRRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory