SitesBLAST
Comparing BPHYT_RS22700 FitnessBrowser__BFirm:BPHYT_RS22700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 52% coverage: 171:391/426 of query aligns to 141:359/369 of S5FMM4
- S202 (≠ G232) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ M364) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L374) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 58% coverage: 137:382/426 of query aligns to 107:350/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y283), R302 (≠ M336), R329 (≠ G361)
- binding flavin-adenine dinucleotide: V174 (= V204), S202 (≠ G232), G203 (= G233), W205 (≠ Y235), F209 (≠ V239), G300 (= G334), R302 (≠ M336), H327 (≠ F359), R329 (≠ G361), N330 (≠ H362), G331 (= G363), I332 (≠ M364)
- binding phosphate ion: R254 (= R291)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 58% coverage: 137:382/426 of query aligns to 107:350/369 of O31616
- V174 (= V204) binding
- H244 (≠ R278) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ M336) binding
- 327:333 (vs. 359:365, 14% identical) binding
- R329 (≠ G361) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
24% identity, 58% coverage: 137:382/426 of query aligns to 107:350/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P203), V174 (= V204), S202 (≠ G232), G203 (= G233), W205 (≠ Y235), F209 (≠ V239), G300 (= G334), R302 (≠ M336), H327 (≠ F359), F328 (≠ G360), R329 (≠ G361), N330 (≠ H362), G331 (= G363), I332 (≠ M364)
- binding glycolic acid: Y246 (= Y283), R302 (≠ M336), R329 (≠ G361)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
Query Sequence
>BPHYT_RS22700 FitnessBrowser__BFirm:BPHYT_RS22700
MQSFYEATVTRSSAYAPLAGRRAANVCVIGGGLAGLSTALGLAERGVADVTVLEARQVGF
GASGRNGGFVFGGYSLDCADLLKTLGAVRARELYTLTTDAVDLMRKRIARYHIDCDATDA
GVILANWFDEPARLESQRRLMRDSFGVEWEPVAAQQLASQLKTRRYHSGLFERNAFHFHP
LKYVLGVANAAAHAGVQIHEDSPVVRLERDGAGFVVHTQHGVLDARHVVMAGGGYARRVY
PRVERAVLPIATYVMATEPLGARLQDAIDTRAAIYDTRFAFDYYRPLPDTRILWGGRISV
RDREPEVIARLLRRDLLKVYPQLHGVRIDYAWGGLMSYARHKMPQIGRSADGVWYAVGFG
GHGMAPTTVSGELLAAAIAGERPVPEAFASFGLTPAYGALGLAAAQLTYTAMQTRDALAA
RRRPAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory