Comparing BPHYT_RS22715 FitnessBrowser__BFirm:BPHYT_RS22715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase; L-KDA dehydratase; 2-dehydro-3-deoxy-L-arabinonate dehydratase; L-2-keto-3-deoxyarabinonate dehydratase; EC 4.2.1.43 from Azospirillum brasilense (see paper)
70% identity, 100% coverage: 1:309/310 of query aligns to 1:308/309 of Q1JUQ0
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
31% identity, 84% coverage: 8:266/310 of query aligns to 1:256/291 of 3na8A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 78% coverage: 8:249/310 of query aligns to 1:242/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 78% coverage: 8:249/310 of query aligns to 1:242/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 78% coverage: 8:249/310 of query aligns to 1:242/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 78% coverage: 8:249/310 of query aligns to 1:242/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 78% coverage: 8:249/310 of query aligns to 1:242/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 78% coverage: 8:249/310 of query aligns to 1:242/298 of 3nevA
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
26% identity, 94% coverage: 10:299/310 of query aligns to 3:290/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 53% coverage: 10:172/310 of query aligns to 2:161/294 of Q9X1K9
Sites not aligning to the query:
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
27% identity, 92% coverage: 10:294/310 of query aligns to 2:283/294 of 4i7wA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
26% identity, 82% coverage: 19:273/310 of query aligns to 17:265/296 of 1xxxA
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
26% identity, 82% coverage: 19:273/310 of query aligns to 16:264/295 of 3l21B
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
26% identity, 82% coverage: 19:273/310 of query aligns to 18:266/297 of 5j5dA
Sites not aligning to the query:
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 82% coverage: 19:273/310 of query aligns to 21:269/300 of P9WP25
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
27% identity, 92% coverage: 10:294/310 of query aligns to 2:283/294 of Q8UGL3
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
26% identity, 61% coverage: 19:206/310 of query aligns to 11:195/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
26% identity, 61% coverage: 19:206/310 of query aligns to 11:195/292 of 3puoA
Sites not aligning to the query:
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
24% identity, 40% coverage: 25:147/310 of query aligns to 19:138/291 of 3di1B
Sites not aligning to the query:
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
24% identity, 40% coverage: 25:147/310 of query aligns to 19:138/295 of Q5HG25
Sites not aligning to the query:
>BPHYT_RS22715 FitnessBrowser__BFirm:BPHYT_RS22715
MTQSSHPAAMRGVFPVAPTIFDDAGRLDLEGQKRCIDFMIDAGSNGLCILANFSEQFALS
DDERNTLMHVVLEHVAGRVPVIVTTTHFSSYQCAERSRSAQAAGAAMVMVMPPYHGATIR
IGERGIYEFYRTVSDAIGIPIMIQDAPVSGTPLSAPFLARMAREIDNVSYFKIEVPQAAN
KLRELIELGGDAIVGPWDGEEAITLMADLDAGATGSMTGGGYADGIRLIVDAYAAGDTEA
AAAHYQQWLPLINYENRQGGLASCKALMKEGGVIRSDAVRHPLPQMHPATREGLLKVARR
LDPLVLRWGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory