Comparing BPHYT_RS22735 FitnessBrowser__BFirm:BPHYT_RS22735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 94% coverage: 13:260/265 of query aligns to 4:244/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 82% coverage: 12:227/265 of query aligns to 1:206/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 82% coverage: 11:227/265 of query aligns to 1:208/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 82% coverage: 11:227/265 of query aligns to 1:208/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 82% coverage: 11:227/265 of query aligns to 1:208/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 82% coverage: 11:227/265 of query aligns to 1:208/242 of 2oljA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 86% coverage: 10:237/265 of query aligns to 1:230/253 of 1g9xB
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 82% coverage: 13:229/265 of query aligns to 1:200/348 of 3d31A
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 86% coverage: 10:237/265 of query aligns to 1:230/254 of 1g6hA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 78% coverage: 21:227/265 of query aligns to 9:206/240 of 4ymuJ
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 82% coverage: 11:227/265 of query aligns to 1:209/230 of 6z4wA
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 82% coverage: 39:255/265 of query aligns to 37:246/265 of P07821
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 81% coverage: 13:227/265 of query aligns to 3:209/229 of 6z67B
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 86% coverage: 8:234/265 of query aligns to 12:225/378 of P69874
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
29% identity, 79% coverage: 17:226/265 of query aligns to 7:211/226 of 5xu1B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 82% coverage: 13:229/265 of query aligns to 2:211/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 82% coverage: 13:229/265 of query aligns to 4:213/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 82% coverage: 13:229/265 of query aligns to 4:213/263 of 7d08B
5x40A Structure of a cbio dimer bound with amppcp (see paper)
30% identity, 84% coverage: 12:234/265 of query aligns to 3:217/280 of 5x40A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 85% coverage: 22:245/265 of query aligns to 14:229/353 of 1oxvD
Sites not aligning to the query:
>BPHYT_RS22735 FitnessBrowser__BFirm:BPHYT_RS22735
MSTPTSASSAMPVLQARGLIKRYGNVTALDGCDFEVMPGEIMAVIGDNGAGKSSLIKALS
GATVPDEGEILLDGKPVKFRSPLDARAQGIETVYQELAVAPAMSIAENLFLARELLKPGW
RGSIFKMIDKRRMLDEATAHMKDLQIGIRSMRQAVETLSGGQRQGVAVARSAAFARHVVI
LDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVFEIADRIHIQRLGRRAALVN
RADIHMSEAVAIMTGAKEADVKAIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory