Comparing BPHYT_RS22765 FitnessBrowser__BFirm:BPHYT_RS22765 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
O69315 Beta-galactosidase; Beta-gal; Lactase; EC 3.2.1.23 from Thermus thermophilus (see paper)
53% identity, 99% coverage: 3:658/660 of query aligns to 2:642/645 of O69315
1kwkA Crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose (see paper)
53% identity, 99% coverage: 3:658/660 of query aligns to 2:642/644 of 1kwkA
1kwgA Crystal structure of thermus thermophilus a4 beta-galactosidase (see paper)
53% identity, 99% coverage: 3:658/660 of query aligns to 2:642/644 of 1kwgA
6lvwA Polyextremophilic beta-galactosidase from the antarctic haloarchaeon halorubrum lacusprofundi (see paper)
42% identity, 100% coverage: 1:657/660 of query aligns to 1:658/668 of 6lvwA
5e9aB Crystal structure analysis of the cold-adamped beta-galactosidase from rahnella sp. R3 (see paper)
31% identity, 96% coverage: 4:636/660 of query aligns to 16:652/684 of 5e9aB
3ttyA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus in complex with galactose (see paper)
29% identity, 96% coverage: 7:639/660 of query aligns to 15:646/675 of 3ttyA
3ttsA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus (see paper)
29% identity, 96% coverage: 7:639/660 of query aligns to 15:646/675 of 3ttsA
4ucfA Crystal structure of bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose (see paper)
30% identity, 99% coverage: 4:659/660 of query aligns to 20:681/682 of 4ucfA
Sites not aligning to the query:
4uzsA Crystal structure of bifidobacterium bifidum beta-galactosidase (see paper)
29% identity, 99% coverage: 4:659/660 of query aligns to 21:686/687 of 4uzsA
8ibtA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e318s mutant in complex with lacto-n-tetraose (see paper)
30% identity, 99% coverage: 4:659/660 of query aligns to 22:688/694 of 8ibtA
4uniA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 in complex with galactose (see paper)
30% identity, 100% coverage: 3:659/660 of query aligns to 19:688/689 of 4uniA
4uozA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 nucleophile mutant e324a in complex with galactose (see paper)
30% identity, 100% coverage: 3:659/660 of query aligns to 18:687/688 of 4uozA
8ibsA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e160a/e318a mutant in complex with galactose (see paper)
30% identity, 99% coverage: 4:659/660 of query aligns to 22:690/691 of 8ibsA
5dfaA 3d structure of the e323a catalytic mutant of gan42b, a gh42 beta- galactosidase from g. Stearothermophilus (see paper)
31% identity, 74% coverage: 4:492/660 of query aligns to 17:503/685 of 5dfaA
O31529 Beta-galactosidase YesZ; Beta-gal; Probable rhamnogalacturonan beta-galactosidase; EC 3.2.1.23 from Bacillus subtilis (strain 168) (see paper)
28% identity, 86% coverage: 4:571/660 of query aligns to 7:550/663 of O31529
O58247 Exo-beta-D-glucosaminidase; GlcNase; EC 3.2.1.- from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
24% identity, 39% coverage: 13:267/660 of query aligns to 33:309/778 of O58247
Sites not aligning to the query:
>BPHYT_RS22765 FitnessBrowser__BFirm:BPHYT_RS22765
MRLGVCYYPEHWPESMWQDDARRMKALGIEQVRIAEFAWSRIEPTPGEYDWGWLDRSIDV
LGAAGLQVVMCTPTATPPKWLIDRHPDILPVGADGRPRAFGSRRHYDFSSPSYFAASQKI
CTAVAERYGKHPAVAYWQTDNEFGCHHTVVSYSPAAVGRFREWLKARYQTIDALNRAWGT
VFWSMEYRSFDEIDAPVATVTEAHPSHRLDYRRFASDEVARYNRMQVEIIRAHSPGRPVA
HNFMQLFTEFDHYKVAADLDVATWDSYPLGALEEQWFAPEVKARWLRSGHPDFASFNHDV
YRGMSKLPFWVMEQQPGPVNWALWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDVGGNEASQVAGEIRTVLAANADADAAVRSKVALVYDYEAKWLFEI
HPQGADFHYPRFAFEYYSALRALGLDVDVVPVDAPLDGYSLIVVPPLPVVPEAFAQRLAS
SGAQVVLGPRTGSKTKDLQIPANLPPGALTSVLPLRVWRVESMRPNVTEAVRLADGESAG
EADGFARHWRDFIDTDAAQSLDVRARFADGHPAYVQGGAFHYLASLFDDALTVRLFARIA
QEAGLETMPLGDSVRVSRRGALTYVFNYGDETHTLSGVADDALVFGSRAIEPQGVAVYRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory