SitesBLAST
Comparing BPHYT_RS23020 FitnessBrowser__BFirm:BPHYT_RS23020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
51% identity, 96% coverage: 1:435/451 of query aligns to 5:436/478 of Q47945
- Q37 (≠ S37) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
54% identity, 88% coverage: 40:435/451 of query aligns to 2:398/433 of 8gy2B
- binding heme c: C18 (= C56), C21 (= C59), H22 (= H60), T46 (= T84), I48 (= I86), Y59 (≠ W97), L68 (≠ V106), R73 (≠ K111), V79 (≠ L117), Y80 (= Y118), M83 (= M121), F88 (≠ Y126), R126 (= R164), H165 (= H203), C166 (= C204), C169 (= C207), H170 (= H208), I201 (= I239), A202 (≠ P240), P203 (≠ S241), L205 (= L243), W216 (= W254), F224 (= F262), A234 (= A272), V235 (≠ A273), F236 (= F274), F236 (= F274), M239 (= M277), N301 (= N339), C302 (= C340), C305 (= C343), H306 (= H344), M316 (≠ V354), F317 (= F355), P318 (= P356), L320 (= L358), P324 (= P362), G342 (≠ S380), S352 (= S390), V354 (≠ F392), M356 (= M394), F359 (= F397), M375 (≠ V413)
- binding ubiquinone-10: C21 (= C59), L34 (= L72), P39 (= P77), P81 (= P119), L129 (= L167), W132 (= W170), E168 (≠ A206), R173 (= R211), I197 (= I235), D241 (= D279)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
39% identity, 86% coverage: 44:433/451 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C56), C16 (= C59), H17 (= H60), T42 (= T84), I44 (= I86), Y55 (≠ W97), L75 (= L117), Y76 (= Y118), A78 (= A120), M79 (= M121), R122 (= R164), H161 (= H203), C162 (= C204), C165 (= C207), H166 (= H208), A191 (≠ P240), P192 (≠ S241), R223 (≠ A272), P227 (≠ G276), M228 (= M277), V289 (≠ N339), C290 (= C340), C293 (= C343), H294 (= H344), Y305 (≠ V354), Y306 (≠ F355), P307 (= P356), L309 (= L358), N312 (= N361), T313 (≠ P362), T314 (≠ V363), D322 (≠ S371), I327 (≠ L376), V331 (≠ S380), R333 (≠ T385), I340 (≠ F392), M342 (= M394), P343 (= P395), F345 (= F397)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 86% coverage: 44:433/451 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C56), C16 (= C59), H17 (= H60), T42 (= T84), I44 (= I86), F60 (= F102), L64 (≠ V106), L75 (= L117), Y76 (= Y118), M79 (= M121), P80 (= P122), Y84 (= Y126), R122 (= R164), C162 (= C204), C165 (= C207), H166 (= H208), I186 (= I235), W189 (= W238), A191 (≠ P240), P192 (≠ S241), I194 (≠ L243), W205 (= W254), Y213 (≠ F262), R223 (≠ A272), M228 (= M277), V303 (≠ N339), C304 (= C340), C307 (= C343), H308 (= H344), Y320 (≠ F355), P321 (= P356), L323 (= L358), T327 (≠ P362), T328 (≠ V363), D336 (≠ S371), I341 (≠ L376), V345 (≠ S380), R347 (≠ T385), I354 (≠ F392), M356 (= M394), F359 (= F397), I376 (≠ V409)
- binding ubiquinone-10: M36 (≠ I78), P77 (= P119), S124 (≠ P166), W128 (= W170), C165 (= C207), L173 (≠ S221)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 83% coverage: 44:416/451 of query aligns to 41:410/440 of 8gy3A
- binding heme c: Y52 (≠ D55), C53 (= C56), C56 (= C59), H57 (= H60), S84 (≠ T84), I86 (= I86), W97 (= W97), F102 (= F102), L117 (= L117), F121 (≠ M121), F126 (≠ Y126), R163 (= R164), C203 (= C204), C206 (= C207), H207 (= H208), A232 (≠ P240), P233 (≠ S241), L235 (= L243), W245 (= W254), Y253 (≠ F262), L254 (= L263), G263 (≠ S271), S264 (≠ A272), M269 (= M277), Y292 (≠ L300), C337 (= C340), C340 (= C343), H341 (= H344), P353 (= P356), L355 (= L358), N358 (= N361), N359 (≠ P362), V372 (= V375), I377 (≠ S380), G382 (≠ T385), Q383 (≠ K386), I386 (≠ F392), M388 (= M394), F391 (= F397)
- binding ubiquinone-10: E55 (≠ A58), T76 (= T76), F78 (≠ I78), Y118 (= Y118), P119 (= P119), I160 (≠ L161), G166 (vs. gap), Q167 (≠ L167), F169 (≠ I169), W170 (= W170), H202 (= H203), R210 (= R211), L213 (≠ T214)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
32% identity, 27% coverage: 314:433/451 of query aligns to 4:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C340), C33 (= C343), H34 (= H344), Y46 (≠ F355), P47 (= P356), T54 (≠ V363), V66 (= V375), I67 (≠ L376), R73 (≠ T385), I80 (≠ F392), M82 (= M394), P83 (= P395)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
33% identity, 23% coverage: 332:433/451 of query aligns to 339:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C340), C350 (= C343), H351 (= H344), F362 (= F355), P363 (= P356), P364 (≠ A357), L365 (= L358), S368 (≠ N361), Y370 (≠ V363), I382 (≠ V375), L386 (≠ G379), S387 (= S380), G388 (≠ T381), I390 (≠ E383), V392 (≠ T385), Y397 (≠ S390), N398 (≠ S391), G399 (≠ F392), V400 (≠ T393), M401 (= M394)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
35% identity, 25% coverage: 323:433/451 of query aligns to 344:453/456 of 5oboA
- binding heme c: T360 (≠ N339), C361 (= C340), C364 (= C343), H365 (= H344), P377 (= P356), P378 (≠ A357), L379 (= L358), S382 (≠ N361), F384 (≠ V363), I395 (≠ L372), N401 (≠ T378), G402 (= G379), S413 (= S390), M415 (= M394), M418 (≠ F397)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
35% identity, 25% coverage: 323:433/451 of query aligns to 343:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N339), C360 (= C340), C363 (= C343), H364 (= H344), P376 (= P356), P377 (≠ A357), L378 (= L358), F383 (≠ V363), N400 (≠ T378), G401 (= G379), Y410 (≠ A388), S412 (= S390), M414 (= M394), M417 (≠ F397)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
35% identity, 25% coverage: 323:433/451 of query aligns to 346:455/457 of 4ax3D
- binding heme c: C363 (= C340), C366 (= C343), H367 (= H344), P379 (= P356), P380 (≠ A357), L381 (= L358), S384 (≠ N361), F386 (≠ V363), N403 (≠ T378), G404 (= G379), S415 (= S390), M417 (= M394), M420 (≠ F397)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
33% identity, 23% coverage: 330:433/451 of query aligns to 2:112/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C340), C14 (= C343), H15 (= H344), F26 (= F355), P27 (= P356), L29 (= L358), H32 (≠ N361), Y45 (vs. gap), L54 (= L382), Q55 (≠ E383), G56 (= G384), G67 (≠ F392), M69 (= M394), F72 (= F397)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
33% identity, 23% coverage: 330:433/451 of query aligns to 1:111/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C343), H14 (= H344), P26 (= P356), L28 (= L358), H31 (≠ N361), Y44 (vs. gap), V48 (= V375), Q54 (≠ E383), G55 (= G384), G66 (≠ F392), M68 (= M394)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
33% identity, 23% coverage: 330:433/451 of query aligns to 1:111/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y336), C10 (= C340), C13 (= C343), H14 (= H344), P26 (= P356), H31 (≠ N361), Y44 (vs. gap), Q54 (≠ E383), G55 (= G384), G66 (≠ F392), M68 (= M394), F71 (= F397)
Sites not aligning to the query:
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
33% identity, 23% coverage: 332:433/451 of query aligns to 2:110/129 of 1dt1A
- binding heme c: C9 (= C340), C12 (= C343), H13 (= H344), P25 (= P356), H30 (≠ N361), Y43 (vs. gap), V47 (= V375), Q53 (≠ E383), G54 (= G384), G65 (≠ F392), M67 (= M394), F70 (= F397)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS23020 FitnessBrowser__BFirm:BPHYT_RS23020
MTKKIDIQRLTQAMKRVGAAAVLGMTTLAAHAAAPQSRNDTTLIAHGEYLARAGDCIACH
SAPSGKPFAGGLKFDTPIGAIYSTNITPDRSTGIGSWTFAQFDRAVRAGVKPNGDTLYPA
MPFPSYARLSQDDMHALYAYFTHGVAPVNQKNKPVDIVWPLSMRWPLGIWRHLFAPEPVS
FDAKRYADPVIARGAYLVQGLGHCGACHTPRAATMQERALSEFDGPAFLAGGAAIDGWIP
SSLRGNPRTGIGAWSEADLVQFLKTGRTQHSAAFGGMTDVVQHSMQHMNDADLTAIARYL
KTLPSTDPQETPYAYDDTAARALRMGDASAPGAAVYRDNCTACHRSDGRGYNRVFPALGG
NPVVQGKDATSLIHVLLTGSTLEGTKTAPSSFTMPAFGWRLNDQEVADVTNFVRTSWGNS
GSTVSATDVAKVRKTVTVHAPDMPPGAALSH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory