SitesBLAST
Comparing BPHYT_RS23120 FitnessBrowser__BFirm:BPHYT_RS23120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 82% coverage: 42:386/423 of query aligns to 20:357/374 of 1y56B
- active site: F44 (≠ G66), G47 (= G69), T48 (≠ G70), H224 (vs. gap), P239 (≠ A269), G305 (= G337), M338 (≠ A368)
- binding flavin-adenine dinucleotide: I33 (≠ L55), E34 (≠ D56), K35 (≠ A57), S42 (≠ A64), T43 (≠ S65), R45 (= R67), C46 (≠ N68), G47 (= G69), G49 (vs. gap), E170 (≠ P205), V171 (= V206), T200 (≠ G233), N201 (= N234), W203 (≠ T236), G305 (= G337), Y306 (≠ F338), Y307 (≠ V339), G334 (= G364), H335 (= H365), G336 (= G366), F337 (≠ V367), M338 (≠ A368)
- binding flavin mononucleotide: F44 (≠ G66), R45 (= R67), I260 (≠ D292), R301 (≠ Y333), W303 (= W335)
Sites not aligning to the query:
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
21% identity, 86% coverage: 26:389/423 of query aligns to 24:374/383 of 5i39A
- active site: F66 (≠ N68), Q69 (= Q71), A70 (≠ T72), Q248 (≠ R266), P267 (≠ D285)
- binding flavin-adenine dinucleotide: V30 (≠ I32), G31 (= G33), G33 (= G35), I34 (≠ F36), L35 (≠ S37), V53 (≠ L55), E54 (≠ D56), K55 (≠ A57), Q62 (≠ A64), S63 (= S65), F66 (≠ N68), Y67 (≠ G69), Q69 (= Q71), A196 (≠ P205), A197 (≠ V206), G226 (= G233), G227 (≠ A244), W229 (≠ A246), Q248 (≠ R266), Q250 (≠ D268), G321 (= G337), M323 (≠ V339), T348 (≠ S363), G349 (= G364), W350 (≠ H365), G351 (= G366), M352 (≠ V367), T353 (≠ A368)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 49% coverage: 27:233/423 of query aligns to 43:242/857 of Q63342
- CV 52:53 (≠ FS 36:37) binding
- EK 73:74 (≠ DA 56:57) binding
- 80:88 (vs. 63:73, 27% identical) binding
- H84 (≠ R67) modified: Tele-8alpha-FAD histidine
- V212 (= V206) binding
Sites not aligning to the query:
- 244 binding
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
26% identity, 49% coverage: 27:233/423 of query aligns to 6:205/824 of 4pabB
- active site: T53 (≠ G75), E102 (≠ D134)
- binding flavin-adenine dinucleotide: I11 (= I32), G12 (= G33), G14 (= G35), C15 (≠ F36), V16 (≠ S37), L35 (= L55), E36 (≠ D56), K37 (≠ A57), G43 (= G63), S44 (≠ A64), T45 (≠ S65), H47 (≠ R67), A48 (≠ N68), A49 (≠ G69), G50 (= G70), L51 (= L73), V175 (= V206), A204 (≠ C232), G205 (= G233)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
24% identity, 49% coverage: 26:233/423 of query aligns to 16:218/433 of 5hxwA
- active site: F58 (≠ N68), Q61 (= Q71), A62 (≠ T72)
- binding flavin-adenine dinucleotide: V22 (≠ I32), G23 (= G33), G25 (= G35), I26 (≠ F36), L27 (≠ S37), E46 (≠ D56), K47 (≠ A57), E53 (≠ G63), Q54 (≠ A64), S55 (= S65), R57 (= R67), F58 (≠ N68), Y59 (≠ G69), G60 (= G70), Q61 (= Q71), A188 (≠ P205), A189 (≠ V206), G218 (= G233)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 219, 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 49% coverage: 27:233/423 of query aligns to 50:249/866 of Q9UI17
- CV 59:60 (≠ FS 36:37) binding
- EK 80:81 (≠ DA 56:57) binding
- 87:95 (vs. 63:73, 27% identical) binding
- H91 (≠ R67) modified: Tele-8alpha-FAD histidine
- H109 (≠ G87) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V206) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
Query Sequence
>BPHYT_RS23120 FitnessBrowser__BFirm:BPHYT_RS23120
MIANSYYEASAARPLADDPALDGTLEADVCVIGAGFSGLSVALECRARGLSVVVLDAHRP
GWGASGRNGGQTLVGFAKDEIMERQLGLDGARAAWAMSVEGVSLVRERIEHYGIECDFTS
GYLTVATKPKRVPDLRSWMESASQRWGYTKLSWLDTDEVRSRVASKRYLAGVYDPFSGHL
HPLKYCLGLADAARREGAQLFAHSPVIEVVRGARPVVRTARGEVRCRFVAACGNATIGDV
LPAAVAARIAPIASYIVATEPLGKERADALIKGREAICDNNFFLDYFRLSADHRVLFGGR
ASSTGASPVQLGEEIRQRMIGVFPQLGDVKIDYAWGGFVDVTRNRAPDFGSIDPNYFYVQ
GFSGHGVALTGIAGRVVAQAMAGETKAFDLFARLRHARFPGGPALRGPALELGMMYHRIL
EMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory