Comparing BPHYT_RS23135 FitnessBrowser__BFirm:BPHYT_RS23135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
29% identity, 66% coverage: 63:261/303 of query aligns to 86:285/296 of P68183
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
34% identity, 27% coverage: 141:223/303 of query aligns to 363:440/490 of 4ki0F
Sites not aligning to the query:
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
34% identity, 27% coverage: 141:223/303 of query aligns to 378:455/514 of P02916
Sites not aligning to the query:
>BPHYT_RS23135 FitnessBrowser__BFirm:BPHYT_RS23135
MIKPNKTLSNSVLTFGFLFLYIPIISLIVYSFNESKLVTVWSGFSLKWYGALLQDGELLN
AAWLSLKIGLLTACASVVIGTWAGFVLARFGRFRGFTLFAGMINAPLVIPEVIQGISLLL
LFVALEQMLGWPKGRGLFTIWIGHVMLCVSYVAIIVQSRVKELNRSLEEAALDLGATPFK
VFFLITLPLISQALMSGWLLSFTLSFDDLVLSAFLSGPGSTTLPLVVFSRVRLGLNPEMN
ALATIFITTVTIGVIAVNRWMQLRERKRNRDMQMAFALAEAADPLPAAPQQAAARKSLDT
ARA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory