SitesBLAST
Comparing BPHYT_RS23145 FitnessBrowser__BFirm:BPHYT_RS23145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 92% coverage: 29:385/387 of query aligns to 17:372/378 of P69874
- C26 (≠ K38) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F39) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ L57) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C66) mutation to T: Loss of ATPase activity and transport.
- L60 (= L72) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V88) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V147) mutation to M: Loss of ATPase activity and transport.
- D172 (= D184) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ S287) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (= E310) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
41% identity, 82% coverage: 30:345/387 of query aligns to 7:332/375 of 2d62A
1g291 Malk (see paper)
41% identity, 87% coverage: 30:366/387 of query aligns to 4:349/372 of 1g291
- binding magnesium ion: D69 (vs. gap), E71 (vs. gap), K72 (vs. gap), K79 (≠ Y99), D80 (≠ K100), E292 (= E310), D293 (≠ R311)
- binding pyrophosphate 2-: S38 (= S64), G39 (= G65), C40 (= C66), G41 (= G67), K42 (= K68), T43 (≠ S69), T44 (= T70)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 4:339/369 of P19566
- L86 (= L112) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P186) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D191) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (≠ A334) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 3:340/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 1:338/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F39), S35 (= S64), G36 (= G65), C37 (= C66), G38 (= G67), K39 (= K68), S40 (= S69), T41 (= T70), R126 (= R155), A130 (≠ Q159), S132 (= S161), G134 (= G163), Q135 (= Q164)
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 3:340/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F39), S37 (= S64), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (= S69), T43 (= T70), Q81 (= Q108), R128 (= R155), A132 (≠ Q159), S134 (= S161), G136 (= G163), Q137 (= Q164), E158 (= E185), H191 (= H218)
- binding magnesium ion: S42 (= S69), Q81 (= Q108)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 3:340/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F39), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (= S69), T43 (= T70), R128 (= R155), S134 (= S161), Q137 (= Q164)
- binding beryllium trifluoride ion: S37 (= S64), G38 (= G65), K41 (= K68), Q81 (= Q108), S134 (= S161), G136 (= G163), H191 (= H218)
- binding magnesium ion: S42 (= S69), Q81 (= Q108)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 3:340/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F39), V17 (≠ A44), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (= S69), T43 (= T70), R128 (= R155), A132 (≠ Q159), S134 (= S161), Q137 (= Q164)
- binding tetrafluoroaluminate ion: S37 (= S64), G38 (= G65), K41 (= K68), Q81 (= Q108), S134 (= S161), G135 (= G162), G136 (= G163), E158 (= E185), H191 (= H218)
- binding magnesium ion: S42 (= S69), Q81 (= Q108)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
39% identity, 87% coverage: 30:366/387 of query aligns to 3:340/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F39), V17 (≠ A44), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (= S69), T43 (= T70), R128 (= R155), A132 (≠ Q159), S134 (= S161), Q137 (= Q164)
- binding magnesium ion: S42 (= S69), Q81 (= Q108)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 87% coverage: 30:366/387 of query aligns to 4:341/371 of P68187
- A85 (= A111) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P132) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V140) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A143) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ N145) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S150) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G163) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D184) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R254) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ L265) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (≠ S292) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (= G300) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ G304) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (≠ S306) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (= G328) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (≠ A334) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (= S348) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (= G365) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
Sites not aligning to the query:
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
50% identity, 62% coverage: 30:270/387 of query aligns to 7:241/353 of 1vciA
8hprC Lpqy-sugabc in state 4 (see paper)
45% identity, 61% coverage: 32:269/387 of query aligns to 5:245/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F39), S38 (= S64), G39 (= G65), G41 (= G67), K42 (= K68), S43 (= S69), Q82 (= Q108), Q133 (= Q159), G136 (= G162), G137 (= G163), Q138 (= Q164), H192 (= H218)
- binding magnesium ion: S43 (= S69), Q82 (= Q108)
8hprD Lpqy-sugabc in state 4 (see paper)
45% identity, 61% coverage: 32:269/387 of query aligns to 5:245/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F39), S38 (= S64), C40 (= C66), G41 (= G67), K42 (= K68), S43 (= S69), T44 (= T70), Q82 (= Q108), R129 (= R155), Q133 (= Q159), S135 (= S161), G136 (= G162), G137 (= G163), Q159 (≠ E185), H192 (= H218)
- binding magnesium ion: S43 (= S69), Q82 (= Q108)
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 83% coverage: 44:366/387 of query aligns to 16:324/384 of 8hplC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 62% coverage: 32:272/387 of query aligns to 6:249/393 of P9WQI3
- H193 (= H218) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 83% coverage: 29:349/387 of query aligns to 1:312/348 of 3d31A
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 79% coverage: 32:337/387 of query aligns to 6:308/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 79% coverage: 32:337/387 of query aligns to 6:308/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 79% coverage: 32:337/387 of query aligns to 6:308/353 of 1oxuA
Query Sequence
>BPHYT_RS23145 FitnessBrowser__BFirm:BPHYT_RS23145
MNSTTSKSAAGATQMARPAVTTKSKSDEFVRIENVVKKFGDSTAVDNVNLSIAKNELFAL
LGSSGCGKSTLLRMLAGLETVTSGRIFVDGEDLAAMPPYKRPVNMMFQSYALFPHMSVEA
NIAFGLKQEGTPKNEIKERVADALNLVQMSKYAQRKPHQLSGGQQQRVALARSLVKRPKL
LLLDEPMSALDKKIRQKTQLELVNIIEKVDVTCVMVTHDQEEAMTMAGRLAVMSEGRIVQ
IGSPSQVYEFPNSRFSAEFIGSTNLFEGTVVADEPDHIFVESEELESRIYVSHGITGPLG
MPVGISVRPERIKVSLDKPTTPHNWARGVVADVAYMGSYSLYHVRLPSGKTVVSNLSSSH
LMAEGAPSYNDDVFVYWSPASGVVLTQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory