Comparing BPHYT_RS23155 FitnessBrowser__BFirm:BPHYT_RS23155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q9xAAA Probable aminotransferase
60% identity, 93% coverage: 30:479/482 of query aligns to 1:449/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
60% identity, 93% coverage: 30:479/482 of query aligns to 1:449/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
60% identity, 93% coverage: 31:479/482 of query aligns to 1:448/453 of 6s4gA
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
60% identity, 88% coverage: 58:479/482 of query aligns to 1:421/427 of 4ba5A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
55% identity, 93% coverage: 32:479/482 of query aligns to 3:449/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
55% identity, 93% coverage: 31:480/482 of query aligns to 1:443/443 of 7qx0B
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
60% identity, 87% coverage: 59:479/482 of query aligns to 1:417/423 of 4a6rA
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
55% identity, 88% coverage: 58:480/482 of query aligns to 1:422/422 of 7qx3A
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
56% identity, 87% coverage: 59:476/482 of query aligns to 1:380/384 of 5ti8B
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
50% identity, 91% coverage: 33:473/482 of query aligns to 4:445/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
50% identity, 91% coverage: 33:473/482 of query aligns to 4:445/455 of 7ypnD
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
44% identity, 93% coverage: 32:479/482 of query aligns to 6:460/460 of 5kr6B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
40% identity, 92% coverage: 31:473/482 of query aligns to 4:444/448 of 6io1B
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 91% coverage: 39:479/482 of query aligns to 11:458/459 of 5kquC
5ghgB Transaminase w58l with smba
40% identity, 91% coverage: 37:475/482 of query aligns to 6:423/433 of 5ghgB
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 92% coverage: 38:479/482 of query aligns to 11:457/458 of 5kr3A
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
41% identity, 91% coverage: 38:476/482 of query aligns to 8:453/455 of 5kr5A
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
39% identity, 92% coverage: 39:480/482 of query aligns to 7:450/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
39% identity, 92% coverage: 39:480/482 of query aligns to 7:450/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
39% identity, 92% coverage: 39:480/482 of query aligns to 7:450/451 of 6g4eA
>BPHYT_RS23155 FitnessBrowser__BFirm:BPHYT_RS23155
MSYRTEEVAYVQPAQPAASAQASQAAQQQRSTAEYRALDAAHHIHPFSDMGSLNRSGSRV
IVKAQGVYLWDSEGNKVIDGMAGLWCVNVGYGRKELADAAYKQMQELPYYNTFFKTTHPP
VIELSALLAELAPEAFNHFFYCNSGSEGNDTVLRIVHQYWATQGKHSKKFVISRKNGYHG
STIAGGTLGGMGYMHEQMPSKVENIVHIDQPYFFGEAQGNLTPEEFALARAQQLEAKILE
IGADNVAAFIGEPFQGAGGVIFPASTYWPEIQRICRKYDILLVADEVIGGFGRTGEWFAH
QHFGFEPDLITLAKGLTSGYVPMGAVGLHDRVAKAIIENGDFNHGLTYSGHPVAAAVAVA
NLKLLRDEKIVDRVKNDTGPYFQKQLRETFANHPIIGEISGTGLVAGLQLAQDPKARKRF
ANGGDVGTICRDFCFNGNLIMRATGDRMLLSPPLVINKLEIDEIVSKAKKAIDATAQQLG
IS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory