Comparing BPHYT_RS23165 FitnessBrowser__BFirm:BPHYT_RS23165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
56% identity, 94% coverage: 1:247/264 of query aligns to 6:251/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
56% identity, 93% coverage: 3:247/264 of query aligns to 2:245/249 of 7d53A
7d4rB Spua native structure (see paper)
49% identity, 92% coverage: 5:247/264 of query aligns to 2:213/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
40% identity, 95% coverage: 1:251/264 of query aligns to 4:251/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
40% identity, 95% coverage: 1:251/264 of query aligns to 2:249/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
32% identity, 93% coverage: 4:248/264 of query aligns to 2:224/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 91% coverage: 3:243/264 of query aligns to 64:294/308 of O33341
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
31% identity, 45% coverage: 107:226/264 of query aligns to 358:485/506 of 1vcnA
Sites not aligning to the query:
>BPHYT_RS23165 FitnessBrowser__BFirm:BPHYT_RS23165
MRKKPLVGISADRTMMGVHPSHVVGEKYIAAIVDGSQALAMLLPALGERQSAEDVLATVD
GLLFTGSYSNVEPHRYGGHPSTPGTLHDAARDATTLPLMRAAIAAGVPLLAVCRGFQEMN
VVFGGTLHQSVHAVDGLNDHRENKEDDLDVQYAPSHSITLTQGGLLQRLAGGTNEARVNS
LHGQGVERLGVGLTAEATAPDGLIEAVSVIDARAFALGVQWHPEWKHANDALSTAIFRAF
GDACRDRMRTKAGYGAASAAATHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory