SitesBLAST
Comparing BPHYT_RS23350 FitnessBrowser__BFirm:BPHYT_RS23350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
68% identity, 99% coverage: 1:340/343 of query aligns to 1:340/341 of 1sb8A
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), K170 (= K170), N204 (≠ D204)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (= I28), D47 (= D47), N48 (= N48), F49 (= F49), T51 (= T51), G52 (= G52), D78 (= D78), I79 (= I79), Q98 (≠ E98), A100 (= A100), T117 (≠ V117), A140 (= A140), A141 (= A141), Y166 (= Y166), K170 (= K170), Y193 (= Y193), N195 (= N195), V196 (≠ A196)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S103), S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), N195 (= N195), A209 (= A209), V210 (= V210), W214 (= W214), Y225 (≠ L225), I226 (= I226), N227 (= N227), R234 (= R234), L271 (= L271), R299 (= R299), D302 (= D302), S306 (= S306)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
69% identity, 98% coverage: 4:340/343 of query aligns to 3:339/340 of 1sb9A
- active site: S141 (= S142), S142 (= S143), S143 (= S144), Y165 (= Y166), K169 (= K170), N203 (≠ D204)
- binding nicotinamide-adenine-dinucleotide: G22 (= G23), G25 (= G26), F26 (= F27), I27 (= I28), D46 (= D47), N47 (= N48), F48 (= F49), T50 (= T51), G51 (= G52), D77 (= D78), I78 (= I79), Q97 (≠ E98), A99 (= A100), T116 (≠ V117), A139 (= A140), A140 (= A141), Y165 (= Y166), K169 (= K170), Y192 (= Y193), N194 (= N195), V195 (≠ A196)
- binding uridine-5'-diphosphate-glucose: S141 (= S142), Y165 (= Y166), N194 (= N195), A208 (= A209), V209 (= V210), W213 (= W214), Y224 (≠ L225), I225 (= I226), N226 (= N227), L270 (= L271), R298 (= R299), D301 (= D302)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
66% identity, 98% coverage: 4:340/343 of query aligns to 7:343/345 of Q7BJX9
- GVAGFI 26:31 (= GVAGFI 23:28) binding
- DNFSTG 50:55 (= DNFSTG 47:52) binding
- DI 81:82 (= DI 78:79) binding
- QAA 101:103 (≠ EAA 98:100) binding
- T120 (≠ V117) binding
- SS 145:146 (= SS 142:143) binding
- S147 (= S144) mutation to T: No effect on epimerase activity.
- Y169 (= Y166) binding
- K173 (= K170) binding
- YFN 196:198 (= YFN 193:195) binding
- V199 (≠ A196) binding
- VIPK 213:216 (= VIPK 210:213) binding
- YIN 228:230 (≠ LIN 225:227) binding
- S236 (= S233) mutation to G: No effect on epimerase activity.
- R237 (= R234) binding
- R271 (= R268) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ RAGD 299:302) binding
- R307 (= R304) mutation to A: No effect on epimerase activity.
- H308 (= H305) mutation to A: No effect on epimerase activity.
- S309 (= S306) mutation to Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
66% identity, 98% coverage: 4:340/343 of query aligns to 4:335/336 of 3ruhA
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), K170 (= K170), N204 (≠ D204)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (= I28), D47 (= D47), N48 (= N48), S50 (= S50), T51 (= T51), G52 (= G52), D78 (= D78), I79 (= I79), Q98 (≠ E98), A99 (= A99), A100 (= A100), T117 (≠ V117), A140 (= A140), A141 (= A141), S142 (= S142), Y166 (= Y166), K170 (= K170), Y193 (= Y193), V196 (≠ A196)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (= G102), S103 (= S103), S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), Y193 (= Y193), N195 (= N195), A209 (= A209), V210 (= V210), K213 (= K213), W214 (= W214), Y225 (≠ L225), I226 (= I226), N227 (= N227), R234 (= R234), L271 (= L271), R294 (= R299), D297 (= D302), V298 (= V303), S301 (= S306)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
66% identity, 98% coverage: 4:340/343 of query aligns to 4:335/336 of 3rufA
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), K170 (= K170), N204 (≠ D204)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (= I28), D47 (= D47), N48 (= N48), S50 (= S50), T51 (= T51), G52 (= G52), D78 (= D78), I79 (= I79), Q98 (≠ E98), A99 (= A99), A100 (= A100), T117 (≠ V117), A140 (= A140), Y166 (= Y166), K170 (= K170), Y193 (= Y193), V196 (≠ A196)
- binding uridine-5'-diphosphate: N195 (= N195), A209 (= A209), V210 (= V210), K213 (= K213), W214 (= W214), Y225 (≠ L225), I226 (= I226), N227 (= N227), R234 (= R234), L271 (= L271), R294 (= R299), D297 (= D302)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
66% identity, 98% coverage: 4:340/343 of query aligns to 4:335/336 of 3lu1A
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), K170 (= K170), N204 (≠ D204)
- binding glycine: Q135 (≠ S135), K187 (= K187)
- binding nicotinamide-adenine-dinucleotide: G23 (= G23), G26 (= G26), F27 (= F27), I28 (= I28), D47 (= D47), N48 (= N48), S50 (= S50), T51 (= T51), G52 (= G52), D78 (= D78), I79 (= I79), Q98 (≠ E98), A99 (= A99), A100 (= A100), A140 (= A140), A141 (= A141), S142 (= S142), Y166 (= Y166), K170 (= K170), Y193 (= Y193), N195 (= N195)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S103), S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y166), N195 (= N195), V210 (= V210), W214 (= W214), Y225 (≠ L225), I226 (= I226), N227 (= N227), R234 (= R234), L271 (= L271), R294 (= R299), D297 (= D302)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
36% identity, 94% coverage: 15:337/343 of query aligns to 2:307/310 of 6dntA
- active site: S120 (= S142), S121 (= S143), A122 (≠ S144), Y144 (= Y166), K148 (= K170), A187 (= A209)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ G102), S120 (= S142), S121 (= S143), Y144 (= Y166), F172 (= F194), N173 (= N195), A187 (= A209), V188 (= V210), K191 (= K213), V203 (≠ L225), I204 (= I226), Y205 (≠ N227), Q210 (≠ T232), R212 (= R234), I246 (≠ L271), R269 (= R292), D272 (= D302)
- binding nicotinamide-adenine-dinucleotide: G10 (= G23), G13 (= G26), F14 (= F27), I15 (= I28), D33 (= D47), N34 (= N48), L35 (≠ F49), S36 (= S50), S37 (≠ T51), G38 (= G52), D57 (= D78), L58 (≠ I79), L76 (≠ E98), A77 (= A99), A78 (= A100), A80 (≠ G102), S118 (≠ A140), S119 (≠ A141), Y144 (= Y166), K148 (= K170), Y171 (= Y193), V174 (≠ A196)
- binding zinc ion: E209 (= E231), H275 (= H305)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
37% identity, 92% coverage: 20:336/343 of query aligns to 4:304/309 of 4zrnA
- active site: T117 (≠ S142), G119 (vs. gap), A120 (≠ S144), Y143 (= Y166), K147 (= K170), Y181 (≠ D204), G185 (≠ A209)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D31 (= D47), N32 (= N48), S34 (= S50), S35 (≠ T51), G36 (= G52), S51 (≠ W69), I52 (= I75), L73 (≠ E98), A74 (= A99), A75 (= A100), T92 (≠ V117), S115 (≠ A140), S116 (≠ A141), Y143 (= Y166), K147 (= K170), Y170 (= Y193), V173 (≠ A196)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S142), G119 (vs. gap), A120 (≠ S144), Y143 (= Y166), N172 (= N195), G185 (≠ A209), V186 (= V210), H201 (≠ L225), F203 (≠ N227), Y208 (≠ T232), R210 (= R234), V244 (≠ L271), R267 (= R299), D270 (= D302)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
34% identity, 92% coverage: 17:331/343 of query aligns to 2:303/308 of 6wj9B
- active site: A119 (≠ S142), A120 (≠ S143), A121 (≠ S144), F144 (≠ Y166), K148 (= K170)
- binding nicotinamide-adenine-dinucleotide: G8 (= G23), G11 (= G26), F12 (= F27), I13 (= I28), D32 (= D47), D33 (≠ N48), S35 (= S50), T36 (= T51), G37 (= G52), D55 (= D78), A56 (≠ I79), L75 (≠ E98), A76 (= A99), A77 (= A100), S94 (≠ V117), A117 (= A140), A119 (≠ S142), F144 (≠ Y166), K148 (= K170), F171 (≠ Y193), F172 (= F194), I174 (≠ A196)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V104), N173 (= N195), G187 (≠ A209), V188 (= V210), F192 (≠ W214), T203 (≠ L225), L204 (≠ I226), F205 (≠ N227), R212 (= R234), L248 (= L271), R271 (= R299), D274 (= D302)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
34% identity, 92% coverage: 17:331/343 of query aligns to 1:302/307 of 6wjaA
- active site: A118 (≠ S142), A119 (≠ S143), A120 (≠ S144), F143 (≠ Y166), K147 (= K170)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D31 (= D47), D32 (≠ N48), S34 (= S50), T35 (= T51), G36 (= G52), A55 (≠ I79), L74 (≠ E98), A75 (= A99), A76 (= A100), S93 (≠ V117), F143 (≠ Y166), K147 (= K170), F170 (≠ Y193), F171 (= F194), I173 (≠ A196)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V104), A120 (≠ S144), N172 (= N195), G186 (≠ A209), V187 (= V210), F191 (≠ W214), T202 (≠ L225), F204 (≠ N227), R211 (= R234), L247 (= L271), R270 (= R299), D273 (= D302)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
34% identity, 93% coverage: 20:338/343 of query aligns to 19:325/336 of 6pnlA
- active site: S133 (= S142), C135 (≠ S143), G136 (≠ S144), Y159 (= Y166), K163 (= K170)
- binding nicotinamide-adenine-dinucleotide: G22 (= G23), G25 (= G26), C26 (≠ F27), D46 (= D47), N47 (= N48), L48 (≠ F49), S49 (= S50), S50 (≠ T51), S51 (≠ G52), D68 (= D78), I69 (= I79), L89 (≠ E98), A91 (= A100), F93 (≠ G102), V108 (= V117), S131 (≠ A140), S133 (= S142), Y159 (= Y166), K163 (= K170), F186 (≠ Y193), N188 (= N195), V189 (≠ A196), R200 (≠ A208)
- binding uridine-5'-diphosphate: N188 (= N195), N201 (≠ A209), V202 (= V210), F206 (≠ W214), P217 (≠ L225), I218 (= I226), T219 (≠ N227), R226 (= R234), V262 (≠ L271), R285 (= R299)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
34% identity, 93% coverage: 20:338/343 of query aligns to 13:319/330 of 6pmhA
- active site: S127 (= S142), C129 (≠ S143), G130 (≠ S144), Y153 (= Y166), K157 (= K170)
- binding adenosine monophosphate: G16 (= G23), G19 (= G26), D40 (= D47), N41 (= N48), S43 (= S50), S44 (≠ T51), S45 (≠ G52), D62 (= D78), I63 (= I79), A84 (= A99), F87 (≠ G102), R194 (≠ A208)
- binding uridine-5'-diphosphate: C129 (≠ S143), N182 (= N195), N195 (≠ A209), V196 (= V210), F200 (≠ W214), P211 (≠ L225), I212 (= I226), T213 (≠ N227), R220 (= R234), V256 (≠ L271), R279 (= R299)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
30% identity, 94% coverage: 18:339/343 of query aligns to 3:318/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G23), G11 (= G26), F12 (= F27), I13 (= I28), D32 (= D47), N33 (= N48), N35 (≠ S50), Y38 (= Y53), K43 (≠ D58), D61 (= D78), L62 (≠ I79), L83 (≠ E98), A84 (= A99), A85 (= A100), A118 (= A140), Y145 (= Y166), K149 (= K170), F172 (≠ Y193), F173 (= F194), T174 (≠ N195), V175 (≠ A196), R181 (≠ D202)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
33% identity, 92% coverage: 20:336/343 of query aligns to 4:308/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D31 (= D47), N32 (= N48), T35 (= T51), G36 (= G52), D56 (= D78), I57 (= I79), L77 (≠ E98), A78 (= A99), A79 (= A100), I81 (≠ G102), V96 (= V117), T119 (≠ A140), Y146 (= Y166), K150 (= K170), P173 (≠ Y193), A174 (≠ F194), N175 (= N195), V176 (≠ A196)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G102), R84 (≠ P105), S121 (= S142), G123 (≠ S143), Y146 (= Y166), A174 (≠ F194), N175 (= N195), A187 (= A208), G188 (≠ A209), V189 (= V210), F193 (≠ W214), R204 (≠ L225), V205 (≠ I226), F206 (≠ N227), R213 (= R234), D248 (≠ L271), R271 (= R299)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
33% identity, 92% coverage: 20:336/343 of query aligns to 4:308/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D31 (= D47), N32 (= N48), T35 (= T51), G36 (= G52), D56 (= D78), I57 (= I79), L77 (≠ E98), A78 (= A99), A79 (= A100), I81 (≠ G102), T119 (≠ A140), Y146 (= Y166), K150 (= K170), P173 (≠ Y193), N175 (= N195), V176 (≠ A196)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ G102), R84 (≠ P105), S121 (= S142), G123 (≠ S143), S124 (= S144), Y146 (= Y166), A174 (≠ F194), N175 (= N195), G188 (≠ A209), V189 (= V210), F193 (≠ W214), R204 (≠ L225), V205 (≠ I226), F206 (≠ N227), N211 (≠ T232), R213 (= R234), D248 (≠ L271), R271 (= R299)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
33% identity, 92% coverage: 20:336/343 of query aligns to 4:308/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ G102), R84 (≠ P105), S121 (= S142), G123 (≠ S143), Y146 (= Y166), A174 (≠ F194), N175 (= N195), A187 (= A208), G188 (≠ A209), V189 (= V210), F193 (≠ W214), R204 (≠ L225), F206 (≠ N227), N211 (≠ T232), R213 (= R234), D248 (≠ L271), R271 (= R299)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D31 (= D47), N32 (= N48), A34 (≠ S50), T35 (= T51), G36 (= G52), D56 (= D78), I57 (= I79), L77 (≠ E98), A78 (= A99), A79 (= A100), I81 (≠ G102), T119 (≠ A140), Y146 (= Y166), K150 (= K170), P173 (≠ Y193), A174 (≠ F194), V176 (≠ A196)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G102), R84 (≠ P105), S121 (= S142), G123 (≠ S143), Y146 (= Y166), A174 (≠ F194), N175 (= N195), A187 (= A208), G188 (≠ A209), V189 (= V210), F193 (≠ W214), R204 (≠ L225), F206 (≠ N227), N211 (≠ T232), R213 (= R234), D248 (≠ L271), R271 (= R299)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
30% identity, 90% coverage: 20:329/343 of query aligns to 4:303/321 of 6zllA
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y166), K153 (= K170)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D32 (= D47), H33 (≠ N48), F34 (= F49), I35 (≠ S50), K43 (≠ E59), D62 (= D78), I63 (= I79), L81 (≠ E98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), Y149 (= Y166), K153 (= K170), Y176 (= Y193), V179 (≠ A196), R185 (≠ D202), M188 (≠ G205)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ G102), V87 (= V104), R88 (≠ P105), T126 (≠ S142), S127 (= S143), Y149 (= Y166), T178 (≠ N195), R185 (≠ D202), A189 (= A206), R192 (≠ A209), T204 (≠ L225), F206 (≠ N227), Q211 (≠ T232), R213 (= R234), I250 (≠ L271), E276 (≠ D302)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
30% identity, 90% coverage: 20:329/343 of query aligns to 4:303/314 of 6zldA
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y166), K153 (= K170)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D32 (= D47), H33 (≠ N48), F34 (= F49), I35 (≠ S50), K43 (≠ E59), D62 (= D78), I63 (= I79), L81 (≠ E98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), K153 (= K170), Y176 (= Y193), T178 (≠ N195), R185 (≠ D202), M188 (≠ G205)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ G102), R88 (≠ P105), T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y166), F177 (= F194), T178 (≠ N195), R185 (≠ D202), M188 (≠ G205), A189 (= A206), R192 (≠ A209), T204 (≠ L225), F206 (≠ N227), Q211 (≠ T232), R213 (= R234), I250 (≠ L271), E276 (≠ D302)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
30% identity, 90% coverage: 20:329/343 of query aligns to 4:303/314 of 6zl6A
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y166), K153 (= K170)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D32 (= D47), H33 (≠ N48), F34 (= F49), I35 (≠ S50), K43 (≠ E59), D62 (= D78), I63 (= I79), L81 (≠ E98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), K153 (= K170), Y176 (= Y193), T178 (≠ N195), V179 (≠ A196), R185 (≠ D202), M188 (≠ G205)
- binding uridine-5'-diphosphate: T178 (≠ N195), A189 (= A206), R192 (≠ A209), T204 (≠ L225), F206 (≠ N227), Q211 (≠ T232), R213 (= R234), I250 (≠ L271), E276 (≠ D302)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
29% identity, 90% coverage: 20:329/343 of query aligns to 4:303/314 of 6zljA
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), F149 (≠ Y166), K153 (= K170)
- binding nicotinamide-adenine-dinucleotide: G7 (= G23), G10 (= G26), F11 (= F27), I12 (= I28), D32 (= D47), H33 (≠ N48), F34 (= F49), I35 (≠ S50), K43 (≠ E59), D62 (= D78), I63 (= I79), L81 (≠ E98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), K153 (= K170), Y176 (= Y193), T178 (≠ N195), V179 (≠ A196), R185 (≠ D202), M188 (≠ G205)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ G102), R88 (≠ P105), T126 (≠ S142), S127 (= S143), S128 (= S144), F149 (≠ Y166), F177 (= F194), T178 (≠ N195), R185 (≠ D202), M188 (≠ G205), A189 (= A206), R192 (≠ A209), T204 (≠ L225), F206 (≠ N227), Q211 (≠ T232), R213 (= R234), I250 (≠ L271), E276 (≠ D302)
Query Sequence
>BPHYT_RS23350 FitnessBrowser__BFirm:BPHYT_RS23350
MPDRYDTVRQQLAGRPQQWLITGVAGFIGSNLLEALLKLDQTVVGLDNFSTGYQRNLDEV
RSVVSPEQWKRFRFIEGDIRRLEDCVSAVHGVDHVLHEAALGSVPRSVADPIATHEVNIS
GFLNMLVAARDAQVSSFTYAASSSTYGDHLGLPKVEDQIGQPLSPYAVTKYANELYASVF
ARAYGFKTIGLRYFNAFGKRQDPDGAYAAVIPKWTAALIAGDDVLINGDGETSRDFCFVD
NVVQANILAAMSDETARNEVYNVAVGDRTTLIQLYDGLRAVLTDNGVRCDKRPVFGPFRA
GDVRHSQANVDKAERLLGYENRISFVEGLSRAMPWYIEFVSKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory