Comparing BPHYT_RS23420 FitnessBrowser__BFirm:BPHYT_RS23420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wd1A Acetoacetyl-coa synthetase from streptomyces lividans (see paper)
37% identity, 64% coverage: 17:666/1021 of query aligns to 2:645/646 of 4wd1A
P11454 Enterobactin synthase component F; Enterochelin synthase F; Nonribosomal peptide synthetase EntF; EC 6.3.2.14; EC 6.2.1.72 from Escherichia coli (strain K12) (see 5 papers)
25% identity, 74% coverage: 116:870/1021 of query aligns to 470:1170/1293 of P11454
Sites not aligning to the query:
O30409 Tyrocidine synthase 3; Tyrocidine synthase III from Brevibacillus parabrevis (see paper)
24% identity, 73% coverage: 129:871/1021 of query aligns to 5679:6348/6486 of O30409
Sites not aligning to the query:
4zxiA Crystal structure of holo-ab3403 a four domain nonribosomal peptide synthetase bound to amp and glycine (see paper)
26% identity, 50% coverage: 509:1014/1021 of query aligns to 840:1307/1314 of 4zxiA
Sites not aligning to the query:
4zxhA Crystal structure of holo-ab3403 a four domain nonribosomal peptide synthetase from acinetobacter baumanii (see paper)
26% identity, 50% coverage: 509:1014/1021 of query aligns to 840:1307/1314 of 4zxhA
Sites not aligning to the query:
5ja2A Entf, a terminal nonribosomal peptide synthetase module bound to the non-native mbth-like protein pa2412 (see paper)
24% identity, 79% coverage: 116:918/1021 of query aligns to 447:1171/1238 of 5ja2A
Sites not aligning to the query:
8w0cA Crystal structure of acetyl-coa synthetase 2 from candida albicans in complex with a cyclopentyl ester amp inhibitor
25% identity, 55% coverage: 93:656/1021 of query aligns to 80:657/667 of 8w0cA
8w0bA Crystal structure of acetyl-coa synthetase 2 from candida albicans in complex with a cyclopropyl amp ester inhibitor
25% identity, 55% coverage: 93:656/1021 of query aligns to 80:657/667 of 8w0bA
8w0dA Crystal structure of acetyl-coa synthetase 2 from candida albicans in complex with an isopropyl amp ester inhibitor
25% identity, 55% coverage: 93:656/1021 of query aligns to 79:656/666 of 8w0dA
8v4rA Crystal structure of acetyl-coa synthetase 2 in complex with amp and coa from candida albicans
25% identity, 55% coverage: 93:656/1021 of query aligns to 79:656/666 of 8v4rA
8v4pA Crystal structure of acetyl-coa synthetase 2 in complex with adenosine-5'-allylphosphate from candida albicans
25% identity, 55% coverage: 93:656/1021 of query aligns to 79:651/660 of 8v4pA
8v4oA Crystal structure of acetyl-coa synthetase 2 in complex with amp from candida albicans
25% identity, 55% coverage: 93:656/1021 of query aligns to 79:651/660 of 8v4oA
8w0jA Crystal structure of acetyl-coa synthetase 2 from candida albicans in complex with a propyne amp ester inhibitor
25% identity, 55% coverage: 93:656/1021 of query aligns to 80:652/662 of 8w0jA
7kdsA Crystal structure of acetyl-coa synthetase 2 in complex with adenosine-5'-propylphosphate from candida albicans
25% identity, 55% coverage: 93:656/1021 of query aligns to 79:646/654 of 7kdsA
P9WQD1 Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
24% identity, 57% coverage: 72:658/1021 of query aligns to 54:649/651 of P9WQD1
2p20A Acetyl-coa synthetase, r584a mutation (see paper)
26% identity, 51% coverage: 136:656/1021 of query aligns to 108:635/641 of 2p20A
P27550 Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Escherichia coli (strain K12) (see paper)
27% identity, 51% coverage: 132:656/1021 of query aligns to 108:641/652 of P27550
8w0mA Crystal structure of acetyl-coa synthetase 2 from candida albicans in complex with a acetyl sulfamate amp ester inhibitor
24% identity, 51% coverage: 93:610/1021 of query aligns to 78:594/599 of 8w0mA
5jrhA Crystal structure of salmonella enterica acetyl-coa synthetase (acs) in complex with camp and coenzyme a (see paper)
26% identity, 51% coverage: 136:656/1021 of query aligns to 108:634/640 of 5jrhA
Sites not aligning to the query:
Q89WV5 Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) (see paper)
23% identity, 60% coverage: 48:656/1021 of query aligns to 21:638/648 of Q89WV5
>BPHYT_RS23420 FitnessBrowser__BFirm:BPHYT_RS23420
MNHENFVGASMRMYAREPVFQNLPERVAGSRMSRFTAALENFTGERFADYPELHAYSTRE
FRRFWQCFLQWTEGMEWGGKAEPACVGDECETASFFPNVELNYAQSVLGSKIAPDESPAL
TARYADGRRETMTRGELRERVARLACSLNELGLCPGDRAVAIMRNDAHAIIAALAVTALG
ATLSTAAPETGVQAILDRFEPLEPRILFAHTTQRSFDTAGSIASHVAAVAAALPTLTHVV
CLDETPLPSTVSQPQHSLRDLIVQGDAARFAWRRFPFNHPLFIMFSSGTTGKPKCIVHGA
GGTLLEHLKEHQLHSDLGPGDKLYFHTSCSWMMWNWQLSALASGVEIVTYDGPVSEVDTL
WRMVADERVTVFGTSPAYLKMCEDAGLKPGEQFGLHALRAMMSTGAVLYDSQFEWVRAYV
KPLQLQSISGGTDIIGCFVLGNPNLPVYAGEAQCRSLGLDVQAWNEGAPTSMTGELVCVN
PFPSRPLGFFGDADGSRFHAAYFKANPGVWTHGDIIEFSAQGSARLHGRSDGVLNVRGIN
VSPGEIYRIVSGIGEINQSMVVAQTTHDASGSGQRVVLLLVLRRGAKMSAALASRVRREL
MLQGSAALVPDVIAEVEALPVTHNGKASEAAARDAVNGLPVRNLSSLANPGCVEKISAHP
ALARTRRELPEPGDSAEQVEVYLCALWEQLFSFSPVSRDDNFFELGGHSLLAAQMLAEIR
LATGRTLPLATLIIAPTIARLATVITGERTQDAHPNVVPMRAGRGRPVFMLHSITGSVME
CLTLAGALASERPVYGLQARGLDGDEEPQRCVEEMARVYVRQMRAVQPRGPYALVGYSFG
GLVAFEMAQQLVAAGEKIELLCLLDTYVDERYLPLHEWLSFQYEVMAERVRAFRALSARG
RMAYMKDRVFGAADRIRMRLGRMAARPAADTQGLPPVLRQVRESMRVAMATYRPRRYLGS
PIVYVRASGREGGQGDPLPAWQRVARSGLLVKTIDGAHTDLVVEPNLAMVADTLARRLAG
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory