SitesBLAST
Comparing BPHYT_RS23440 FitnessBrowser__BFirm:BPHYT_RS23440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6dkhC The crystal structure of l-idonate 5-dehydrogenase from escherichia coli str. K-12 substr. Mg1655
41% identity, 92% coverage: 29:347/348 of query aligns to 35:346/346 of 6dkhC
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
34% identity, 99% coverage: 2:346/348 of query aligns to 3:345/348 of 1e3jA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), H43 (≠ S42), H63 (= H62), E64 (= E63), C93 (= C95), C96 (= C98), C99 (= C101), C107 (= C109), T111 (≠ R113), P150 (= P156), G154 (≠ A160), K341 (= K342)
- binding phosphate ion: A174 (≠ C180), A196 (≠ D203), R197 (≠ L204), S198 (= S205), R201 (≠ A208)
- binding zinc ion: C38 (= C37), H63 (= H62), E64 (= E63), C93 (= C95), C96 (= C98), C99 (= C101), C107 (= C109)
1pl6A Human sdh/nadh/inhibitor complex (see paper)
35% identity, 100% coverage: 2:348/348 of query aligns to 9:350/356 of 1pl6A
- active site: C44 (= C37), G45 (= G38), S46 (= S39), H49 (≠ S42), H69 (= H62), E70 (= E63), R99 (≠ C95), D102 (≠ C98), C105 (= C101), S113 (≠ C109), F117 (≠ R113), P156 (= P156), G160 (≠ A160), K344 (= K342)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C37), S46 (= S39), I56 (≠ S49), F59 (= F52), H69 (= H62), E155 (= E155), L274 (= L271), F297 (= F294)
- binding nicotinamide-adenine-dinucleotide: G181 (= G181), P182 (= P182), I183 (= I183), D203 (= D203), L204 (= L204), R208 (≠ A208), C249 (≠ A245), T250 (≠ S246), V272 (= V268), G273 (= G269), L274 (= L271), F297 (= F294), R298 (= R295)
- binding zinc ion: C44 (= C37), H69 (= H62)
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
34% identity, 100% coverage: 2:348/348 of query aligns to 10:351/357 of Q00796
- C45 (= C37) binding
- H70 (= H62) binding
- E71 (= E63) binding
- R110 (≠ M105) to P: in HMNR8; results in protein aggregation
- H135 (≠ V133) to R: in HMNR8; results in protein aggregation
- A153 (≠ S152) to D: in HMNR8; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I183) binding
- D204 (= D203) binding
- R209 (≠ A208) binding
- Q239 (≠ T238) to L: in dbSNP:rs1042079
- N269 (≠ T264) to T: in dbSNP:rs930337
- VG-L 273:275 (≠ VGNL 268:271) binding
- VFR 297:299 (≠ SFR 293:295) binding
- V322 (≠ M318) to I: in HMNR8; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
34% identity, 100% coverage: 2:348/348 of query aligns to 10:351/357 of P27867
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
34% identity, 100% coverage: 2:348/348 of query aligns to 4:345/351 of 3qe3A
- active site: C39 (= C37), G40 (= G38), S41 (= S39), H44 (≠ S42), H64 (= H62), E65 (= E63), R94 (≠ C95), D97 (≠ C98), C100 (= C101), S108 (≠ C109), F112 (≠ R113), P151 (= P156), G155 (≠ A160), K339 (= K342)
- binding glycerol: Y45 (= Y43), F54 (= F52), T116 (≠ S117), R293 (= R295)
- binding zinc ion: C39 (= C37), H64 (= H62), E65 (= E63)
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
34% identity, 100% coverage: 2:348/348 of query aligns to 8:348/354 of P07846
- C43 (= C37) binding
- Y49 (= Y44) binding
- H67 (= H62) binding
- E68 (= E63) binding
- E153 (= E155) binding
- R296 (= R295) binding
- Y297 (≠ F296) binding
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
31% identity, 97% coverage: 4:341/348 of query aligns to 6:338/347 of 5vm2A
- active site: C39 (= C37), G40 (= G38), S41 (= S39), H44 (≠ S42), H65 (= H62), E66 (= E63), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), D113 (≠ R113), P153 (= P156), G157 (≠ A160)
- binding magnesium ion: H65 (= H62), E66 (= E63), E152 (= E155)
- binding zinc ion: C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
33% identity, 91% coverage: 16:333/348 of query aligns to 21:334/348 of O58389
- C42 (= C37) binding
- T44 (≠ S39) mutation to A: Total loss of enzymatic activity.
- H67 (= H62) binding
- E68 (= E63) binding
- C97 (= C95) binding
- C100 (= C98) binding
- C103 (= C101) binding
- C111 (= C109) binding
- E152 (= E155) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I183) binding
- E199 (≠ D203) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ A208) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGN 268:270) binding
- IT 291:292 (vs. gap) binding
- R294 (≠ F294) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
33% identity, 91% coverage: 16:333/348 of query aligns to 19:332/346 of 2dfvA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (≠ S42), H65 (= H62), E66 (= E63), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), K113 (≠ R113), P151 (= P156), A155 (= A160)
- binding nicotinamide-adenine-dinucleotide: G175 (= G181), P176 (= P182), L177 (≠ I183), E197 (≠ D203), P198 (≠ L204), R202 (≠ A208), F241 (≠ A245), S242 (= S246), A244 (≠ S248), L264 (≠ V268), G265 (= G269), L266 (≠ N270), I289 (vs. gap), T290 (vs. gap)
- binding zinc ion: C95 (= C95), C101 (= C101), C109 (= C109)
Sites not aligning to the query:
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
32% identity, 95% coverage: 5:333/348 of query aligns to 7:342/357 of 7y9pA
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
33% identity, 94% coverage: 1:327/348 of query aligns to 4:323/342 of 4ejmA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (≠ S42), H61 (= H62), E62 (= E63), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), R109 (= R113), P147 (= P156), C151 (≠ A160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G179), G172 (= G181), V173 (≠ P182), I174 (= I183), T194 (≠ D203), R195 (≠ L204), Q196 (≠ S205), K199 (≠ A208), C240 (≠ A245), E245 (≠ A250), T246 (≠ G251), L263 (≠ V268), V265 (≠ N270), I291 (≠ R295)
- binding zinc ion: C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
33% identity, 94% coverage: 1:327/348 of query aligns to 4:323/343 of 4ej6A
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (≠ S42), H61 (= H62), E62 (= E63), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), R109 (= R113), P147 (= P156), C151 (≠ A160)
- binding zinc ion: C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109)
Sites not aligning to the query:
A2QAC0 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
30% identity, 93% coverage: 24:345/348 of query aligns to 42:370/386 of A2QAC0
- M70 (≠ F52) mutation to F: Abolishes enzyme activity.
- DI 213:214 (≠ DL 203:204) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-359.
- Y318 (≠ F294) mutation to F: Increases affinity for D-sorbitol.
- A359 (≠ L335) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 213-SR-214.
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
32% identity, 91% coverage: 16:333/348 of query aligns to 21:334/350 of Q5JI69
- L179 (≠ I183) binding
- E199 (≠ D203) binding
- R204 (≠ A208) binding
- LGL 266:268 (≠ VGN 268:270) binding
- IT 291:292 (vs. gap) binding
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
32% identity, 91% coverage: 16:333/348 of query aligns to 19:332/347 of 3gfbA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (≠ S42), H65 (= H62), E66 (= E63), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), K113 (≠ R113), P151 (= P156), A155 (= A160)
- binding nicotinamide-adenine-dinucleotide: G173 (= G179), G175 (= G181), P176 (= P182), L177 (≠ I183), S196 (≠ L202), E197 (≠ D203), P198 (≠ L204), R202 (≠ A208), F241 (≠ A245), S242 (= S246), A244 (≠ S248), L264 (≠ V268), G265 (= G269), L266 (≠ N270), I289 (vs. gap), T290 (vs. gap)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 12:348/348 of query aligns to 13:341/341 of P07913
- C38 (= C37) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
30% identity, 100% coverage: 1:347/348 of query aligns to 4:337/337 of 4ilkA
- active site: C40 (= C37), G41 (= G38), S42 (= S39), H45 (≠ Y43), H59 (= H62), E60 (= E63), C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109), A107 (≠ R113), P145 (= P156), A149 (= A160), K332 (= K342)
- binding manganese (ii) ion: C40 (= C37), H59 (= H62), E60 (= E63), E144 (= E155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G179), G170 (= G181), P171 (= P182), I172 (= I183), D193 (= D203), R194 (≠ L204), R198 (≠ A208), N213 (≠ A223), A235 (= A245), A236 (≠ S246), C237 (≠ G247), I241 (≠ G251), M258 (≠ V268), F260 (≠ L271)
- binding zinc ion: C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109)
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
32% identity, 98% coverage: 8:347/348 of query aligns to 9:338/339 of 5kiaA
- active site: C37 (= C37), G38 (= G38), T39 (≠ S39), H42 (≠ S42), H61 (= H62), E62 (= E63), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), V109 (≠ R113), P147 (= P156), A151 (= A160), K333 (= K342)
- binding calcium ion: D146 (≠ E155), N150 (≠ V159), E288 (vs. gap)
- binding zinc ion: C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109)
B6HI95 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) (see paper)
29% identity, 92% coverage: 25:345/348 of query aligns to 42:369/385 of B6HI95
- DI 212:213 (≠ DL 203:204) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-358.
- S358 (≠ L335) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 212-SR-213.
Query Sequence
>BPHYT_RS23440 FitnessBrowser__BFirm:BPHYT_RS23440
MLAAVLHEPKLIRIDEVDPPEPGPGEVRVRVRAGGICGSDLSYYFKGKSGDFAVREPFVL
GHEVAGEIDSLGEGVTAERRLAPGQRVAVNPGLACGTCRFCVGGMPNHCLNMRFMGSAST
FPHTQGMFRQYIVVAARQCVPVPDGVDFAQASMAEPLAVALHAVKQAGSLVGASVLLVGC
GPIGCILLSVARRAGAHRVVALDLSDRALQVARQLGADQTVNAAERAVIDQWSVQRGTFD
VVIEASGSPAGLDTALHAARAGGTVIQVGNLPAGQSPVAANLVMSKELRYQGSFRFTSEY
AIAADEIASGKVDLRPLMTHAFAMSEANRAFEVALDRSQSMKVHLNFD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory