SitesBLAST
Comparing BPHYT_RS23445 FitnessBrowser__BFirm:BPHYT_RS23445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
28% identity, 97% coverage: 5:420/430 of query aligns to 13:427/430 of P0AA76
- Y29 (= Y21) binding
- D31 (= D23) mutation to N: Loss of galactonate transport activity.
- R32 (= R24) binding
- Y64 (= Y56) binding
- E118 (= E110) mutation to Q: Loss of galactonate transport activity.
- W358 (= W349) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
28% identity, 97% coverage: 5:420/430 of query aligns to 2:408/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
27% identity, 97% coverage: 5:420/430 of query aligns to 5:392/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
24% identity, 93% coverage: 10:410/430 of query aligns to 62:472/495 of Q9NRA2
- K136 (= K73) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ S118) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AI 133:134) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ IR 201:202) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AGQAD 203:207) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (≠ S268) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P274) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ S309) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 87% coverage: 36:410/430 of query aligns to 99:472/495 of Q5Q0U0
- K136 (= K73) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R103) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ F106) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G107) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E110) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (= G111) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ S114) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (≠ S115) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ S118) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ V121) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ AGQAD 203:207) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P274) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ C310) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
24% identity, 87% coverage: 36:410/430 of query aligns to 99:472/495 of Q8BN82
- H183 (≠ S118) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 91% coverage: 18:410/430 of query aligns to 95:492/582 of Q9JI12
- H128 (≠ F49) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R103) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E110) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ Y241) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
20% identity, 91% coverage: 18:410/430 of query aligns to 37:434/452 of 7t3nA
Sites not aligning to the query:
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
24% identity, 87% coverage: 37:410/430 of query aligns to 75:455/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
24% identity, 88% coverage: 39:417/430 of query aligns to 104:482/497 of Q9Y2C5
- A372 (≠ G308) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
24% identity, 79% coverage: 2:339/430 of query aligns to 16:351/452 of Q5EXK5
- D82 (= D68) mutation to A: Loss of activity.
- V311 (≠ F287) mutation to W: Loss of activity.
- D314 (= D290) mutation to A: Loss of activity.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
21% identity, 81% coverage: 6:354/430 of query aligns to 113:448/605 of Q9GQQ0
- E217 (= E110) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 36% coverage: 6:161/430 of query aligns to 27:182/448 of Q51955
- D41 (≠ N20) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D23) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G64) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D68) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G71) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R103) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ N123) mutation to A: Strong decrease in 4-HBA transport.
Sites not aligning to the query:
- 183 H→A: Decrease in 4-HBA transport and chemotaxis.
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 99% coverage: 2:425/430 of query aligns to 1:431/446 of A0A0H2VG78
- D22 (= D23) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R103) mutation to A: Loss of transport activity.
- I105 (≠ F106) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (≠ N123) mutation to A: Loss of transport activity.
- Q137 (≠ S139) mutation to A: Loss of transport activity.
- Q250 (≠ S240) mutation to A: Loss of transport activity.
- Q251 (≠ Y241) mutation to A: Loss of transport activity.
- N256 (= N242) mutation to A: Loss of transport activity.
- W357 (= W349) mutation to A: Loss of transport activity.
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
23% identity, 90% coverage: 12:397/430 of query aligns to 60:446/504 of A2SWM2
- R153 (= R103) mutation to S: In ko157; displays cardia bifida (2 hearts).
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
30% identity, 41% coverage: 34:210/430 of query aligns to 68:240/444 of Q8NLB7
- R103 (≠ K69) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 58% coverage: 8:258/430 of query aligns to 15:244/403 of P77589
- E27 (≠ N20) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D68) mutation D->A,E: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 272 A→H: 30% increase in 3HPP transport activity.
- 276 K→D: Lack of 3HPP transport activity.
O59698 Uncharacterized transporter C36.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 56% coverage: 25:264/430 of query aligns to 156:405/580 of O59698
Sites not aligning to the query:
- 99 modified: Phosphoserine
Q8IVW8 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2 from Homo sapiens (Human) (see 2 papers)
27% identity, 42% coverage: 11:189/430 of query aligns to 106:291/549 of Q8IVW8
- R200 (= R103) mutation to S: Loss of function; does not rescue the cardia bifida phenotype in the morpholino knockdown in zebrafish.
Sites not aligning to the query:
- 319 natural variant: Missing (in DFNB115; uncertain significance; dbSNP:rs749994718)
Q6ZSM3 Monocarboxylate transporter 12; MCT 12; Creatine transporter 2; CRT2; Solute carrier family 16 member 12 from Homo sapiens (Human) (see 3 papers)
24% identity, 94% coverage: 7:410/430 of query aligns to 49:455/516 of Q6ZSM3
- R67 (≠ A25) mutation to A: Abolishes creatine efflux activity. Does not affect plasma membrane localization.
- D95 (≠ F53) mutation to A: Decreases in the creatine efflux activity. Does not affect plasma membrane localization.
- D329 (≠ P274) mutation to A: Decreases creatine efflux activity. Loss of localization to the plasma membrane.
- D360 (≠ L311) mutation to A: Does not affect creatine efflux activity. Does not affect plasma membrane localization.
- D387 (≠ T344) mutation to A: Does not affect creatine efflux activity.
- G437 (= G392) to S: found in a patient with age-related cataract; uncertain significance; decreases creatine transport; dbSNP:rs759863805
Sites not aligning to the query:
- 245:516 natural variant: Missing (in CTRCT47; loss of localization to the plasma membrane; retained in the endoplasmic reticulum where it undergoes degradation by the proteasome; has no dominant effect on wild-type protein expression and localization)
Query Sequence
>BPHYT_RS23445 FitnessBrowser__BFirm:BPHYT_RS23445
MIKSQRWFVVALLFLAGVINYLDRAALSIAAPLIQKDLNFSHAQMGIVFSSFFIGYALFN
FVGGVLSDKVGAKRVFGTAMGVWSVFCGATALATGIGSLIVLRVLFGMGEGPFSSSNSKM
VNNWFPRKEVASAIGVISSGTPLGGALAGPVVGFMAVQFGWRWAFVAIMLLGLLWLVLWA
ATTTEHPHQNSRITPDEIELIRAGQADEHAIAHSASGERLGLRHFLRKPIILATAFAFFS
YNYVLFFFLSWFPTYLTEAHHLSLRDMSFATVIPWLLGSIGLAAGGFISDFILRLTGKPL
LSRKLVLGSCLGAAAVCVALAGRVASTQGAVALMSVSIFFLYVTGAVYWAVIQDTVPREH
VGGVGGFVHLLANLAGVIGPAVTGFIVEATHGNYASAFVLAGVIAVLGAVCSLVWIREPR
ASALNMERAW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory