Comparing BPHYT_RS23610 FitnessBrowser__BFirm:BPHYT_RS23610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 79% coverage: 62:322/331 of query aligns to 6:264/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 79% coverage: 62:322/331 of query aligns to 6:261/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 79% coverage: 62:322/331 of query aligns to 6:258/262 of 6eb3C
1hl7A Gamma lactamase from an aureobacterium species in complex with 3a,4,7, 7a-tetrahydro-benzo [1,3] dioxol-2-one (see paper)
28% identity, 78% coverage: 65:322/331 of query aligns to 14:278/279 of 1hl7A
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
26% identity, 79% coverage: 62:324/331 of query aligns to 8:269/269 of 5h3hB
P25026 Non-heme chloroperoxidase; Chloride peroxidase; Chloroperoxidase P; CPO-P; EC 1.11.1.- from Burkholderia pyrrocinia (Pseudomonas pyrrocinia) (see paper)
28% identity, 66% coverage: 63:279/331 of query aligns to 9:233/278 of P25026
Sites not aligning to the query:
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
25% identity, 78% coverage: 63:321/331 of query aligns to 7:269/271 of 3heaA
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
25% identity, 78% coverage: 63:321/331 of query aligns to 7:269/271 of 3hi4A
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
25% identity, 78% coverage: 63:321/331 of query aligns to 8:270/272 of P22862
Sites not aligning to the query:
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
25% identity, 78% coverage: 63:321/331 of query aligns to 7:269/271 of 3ia2A
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
25% identity, 78% coverage: 63:321/331 of query aligns to 7:269/276 of 8pi1B
Sites not aligning to the query:
6kxhB Alp1u_y247f mutant in complex with fluostatin c (see paper)
31% identity, 34% coverage: 66:177/331 of query aligns to 30:140/294 of 6kxhB
Sites not aligning to the query:
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
26% identity, 75% coverage: 68:314/331 of query aligns to 19:266/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
26% identity, 75% coverage: 68:314/331 of query aligns to 19:266/276 of 4lxiA
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
26% identity, 75% coverage: 68:314/331 of query aligns to 19:266/276 of 4lxhA
4nvrA 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
38% identity, 28% coverage: 72:163/331 of query aligns to 33:128/302 of 4nvrA
Sites not aligning to the query:
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
32% identity, 40% coverage: 62:194/331 of query aligns to 6:143/261 of 2xuaH
Sites not aligning to the query:
1q0zA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma) (see paper)
25% identity, 73% coverage: 63:305/331 of query aligns to 7:277/297 of 1q0zA
1q0rA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat) (see paper)
25% identity, 73% coverage: 63:305/331 of query aligns to 7:277/297 of 1q0rA
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
30% identity, 62% coverage: 98:303/331 of query aligns to 56:263/284 of 7zm4A
Sites not aligning to the query:
>BPHYT_RS23610 FitnessBrowser__BFirm:BPHYT_RS23610
MTRLRTLIGAGSLAALAALFGATQPAPVEAKTVHYANEKACPVVADRPDHKPWIREQIAH
TVNGDIAYFRFGHGTPIVLQTGFRATLAEWDAAFLTDLAKRHEVIVFDNRGIGRSEPAAS
SFTARDMTLDAAALIDTLRLSDVTFVGWSMGGAIAQQLALDAPLAVRRIVLMSAPAPGSL
GVPVTPDVEATLSGNAGTTFMDVMRVLFPPNAVDAAQRCFRQNMFQPASYRPPAISATVT
EGQSVLLHDWSSDEAAAAALKNVRLATLILTGADDQVLPKQNSEALAGQIPHAQLLVVRS
AGHAMMYQYPHALAAAINTFIATSRPPGRAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory