SitesBLAST
Comparing BPHYT_RS24020 FitnessBrowser__BFirm:BPHYT_RS24020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P21213 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Rattus norvegicus (Rat) (see paper)
37% identity, 85% coverage: 24:492/549 of query aligns to 136:610/657 of P21213
- S254 (vs. gap) mutation to A: Complete loss of activity.
1gkmA Histidine ammonia-lyase (hal) from pseudomonas putida inhibited with l-cysteine (see paper)
39% identity, 88% coverage: 10:490/549 of query aligns to 10:491/507 of 1gkmA
- active site: Y53 (= Y52), G60 (= G59), H83 (= H82), N193 (= N191), Y278 (≠ L274), R281 (= R277), F327 (≠ A325), E412 (= E410)
- binding cysteine: G142 (vs. gap), L189 (= L187), N193 (= N191), F327 (≠ A325)
P21310 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 4 papers)
38% identity, 88% coverage: 10:490/549 of query aligns to 11:494/510 of P21310
- S144 (vs. gap) modified: 2,3-didehydroalanine (Ser); mutation S->A,T: Complete loss of activity.; mutation to C: No effect.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q20502 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Caenorhabditis elegans (see paper)
36% identity, 85% coverage: 24:491/549 of query aligns to 152:625/677 of Q20502
- D536 (= D401) mutation to N: In am130; causes strong resistance to nickel and zinc toxicity.
2rjsA Sgtam bound to substrate mimic (see paper)
35% identity, 84% coverage: 24:483/549 of query aligns to 24:502/526 of 2rjsA
- active site: Y52 (= Y52), G59 (= G59), H82 (= H82), N192 (= N191), Y295 (≠ L274), R298 (= R277), F343 (≠ A325), Q429 (≠ E410)
- binding (3R)-3-amino-2,2-difluoro-3-(4-methoxyphenyl)propanoic acid: Y52 (= Y52), G59 (= G59), H82 (= H82), G141 (= G140), L143 (= L142), N192 (= N191), Y295 (≠ L274), R298 (= R277), F343 (≠ A325), Q429 (≠ E410)
2rjrA Substrate mimic bound to sgtam (see paper)
35% identity, 84% coverage: 24:483/549 of query aligns to 24:502/526 of 2rjrA
- active site: Y52 (= Y52), G59 (= G59), H82 (= H82), N192 (= N191), Y295 (≠ L274), R298 (= R277), F343 (≠ A325), Q429 (≠ E410)
- binding (2S,3S)-3-(4-fluorophenyl)-2,3-dihydroxypropanoic acid: Y52 (= Y52), G59 (= G59), H82 (= H82), G141 (= G140), L143 (= L142), N192 (= N191), F343 (≠ A325), Q429 (≠ E410)
2qveA Crystal structure of sgtam bound to mechanism based inhibitor (see paper)
35% identity, 84% coverage: 24:483/549 of query aligns to 24:502/526 of 2qveA
- active site: Y52 (= Y52), G59 (= G59), H82 (= H82), N192 (= N191), Y295 (≠ L274), R298 (= R277), F343 (≠ A325), Q429 (≠ E410)
- binding (3R)-3-amino-2,2-difluoro-3-(4-hydroxyphenyl)propanoic acid: Y52 (= Y52), G59 (= G59), H82 (= H82), G141 (= G140), L143 (= L142), N192 (= N191), Y295 (≠ L274), R298 (= R277), F343 (≠ A325), Q429 (≠ E410)
Q8GMG0 MIO-dependent tyrosine 2,3-aminomutase; Tyrosine ammonia-lyase; EC 5.4.3.6; EC 4.3.1.23 from Streptomyces globisporus (see 3 papers)
34% identity, 84% coverage: 24:483/549 of query aligns to 35:515/539 of Q8GMG0
- Y63 (= Y52) active site, Proton donor/acceptor; mutation to F: Complete loss of activity. It does not affect the over-all structure of the enzyme.
- E71 (≠ A60) mutation to A: Despite a decrease in activity, it shows lyase activity over time and still produced some amount of beta-tyrosine.
- H93 (= H82) binding ; mutation to F: Complete loss of activity.
- A152 (≠ Y141) modified: Crosslink with 154, 5-imidazolinone (Ala-Gly)
- S153 (vs. gap) modified: 2,3-didehydroalanine (Ser)
- G154 (vs. gap) modified: Crosslink with 152, 5-imidazolinone (Ala-Gly)
- N205 (= N191) binding
- Y303 (vs. gap) mutation to A: Despite a decrease in activity, it shows lyase activity over time and still produced some amount of beta-tyrosine.
- R311 (= R277) binding
- Y415 (= Y382) mutation to V: Complete loss of activity.
3kdzA X-ray crystal structure of a tyrosine aminomutase mutant construct with bound ligand (see paper)
34% identity, 84% coverage: 24:483/549 of query aligns to 25:503/527 of 3kdzA
- active site: F53 (≠ Y52), G60 (= G59), H83 (= H82), N193 (= N191), Y296 (≠ L274), R299 (= R277), F344 (≠ A325), Q430 (≠ E410)
- binding tyrosine: F53 (≠ Y52), Y59 (≠ V58), G60 (= G59), H83 (= H82), G142 (= G140), N193 (= N191), Y296 (≠ L274), R299 (= R277), F344 (≠ A325)
3unvA Pantoea agglomerans phenylalanine aminomutase (see paper)
30% identity, 87% coverage: 4:480/549 of query aligns to 4:498/514 of 3unvA
- active site: Y53 (= Y52), G60 (= G59), V83 (≠ H82), L191 (= L189), D291 (= D272), S294 (= S275), G340 (≠ A323), D427 (≠ L408)
- binding phenylalanine: Y53 (= Y52), G60 (= G59), G142 (vs. gap), L144 (= L142), N326 (= N307), F342 (≠ A325)
- binding (3S)-3-amino-3-phenylpropanoic acid: Y53 (= Y52), G60 (= G59), G142 (vs. gap), N193 (= N191), N326 (= N307), F342 (≠ A325)
Q0VZ68 Tyrosine 2,3-aminomutase; Tyrosine ammonia-lyase; EC 5.4.3.6; EC 4.3.1.23 from Chondromyces crocatus (see paper)
33% identity, 83% coverage: 24:480/549 of query aligns to 23:500/531 of Q0VZ68
- F57 (≠ V58) mutation to Y: Loss of aminomutase activity.
- LVPVMI 60:65 (≠ LCDVVV 61:66) mutation to MIYMLV: Shift towards ammonia lyase activity.
- RSHA 79:82 (≠ MSHA 80:83) mutation to TFLS: Total loss of aminomutase activity.
- RSHAA 79:83 (≠ MSHAV 80:84) mutation to YHLAT: Total loss of aminomutase activity.
- G184 (≠ E182) mutation to R: Gain of aminomutase activity.
- K242 (≠ R240) mutation to R: Gain of aminomutase activity.
- 275:288 (vs. 259:267, 36% identical) mutation Missing: Total loss of aminomutase activity.
- P377 (= P358) mutation to R: No effect.
- C396 (≠ S375) mutation to S: No effect.
- E399 (≠ M378) mutation to A: Loss of aminomutase activity and increased product racemization. Gain of ammonia-lyase activity.; mutation to K: Loss of aminomutase and ammonia-lyase activity. Higher enantiomeric excess of (R)-beta-tyrosine.; mutation to M: Loss of aminomutase and ammonia-lyase activity.
- 399:406 (vs. 378:385, 38% identical) mutation to MIAQVTSA: Residual aminomutase activity.
- 427:433 (vs. 406:412, 14% identical) mutation to SAGREDH: Total loss of aminomutase activity.; mutation to SANQEDH: Total loss of aminomutase activity.
6s7qA Crystal structure of ergothioneine degrading enzyme ergothionase from treponema denticola in complex with desmethyl-ergothioneine sulfonic acid (see paper)
29% identity, 89% coverage: 2:489/549 of query aligns to 2:489/497 of 6s7qA
- active site: Y53 (= Y52), G60 (= G59), D275 (= D272), A324 (= A323)
- binding (2~{S})-2-(dimethylamino)-3-(2-sulfo-1~{H}-imidazol-4-yl)propanoic acid: Y53 (= Y52), V59 (= V58), G60 (= G59), S194 (≠ N191), F326 (≠ A325), T380 (≠ I379), K383 (≠ Y382), E411 (= E410)
2o7dA Tyrosine ammonia-lyase from rhodobacter sphaeroides, complexed with caffeate (see paper)
33% identity, 89% coverage: 7:494/549 of query aligns to 8:514/515 of 2o7dA
- active site: Y54 (= Y52), G61 (= G59), L84 (≠ H82), N195 (= N191), Y292 (≠ L274), R295 (= R277), F342 (≠ A325), Q428 (≠ E410)
- binding caffeic acid: G61 (= G59), H83 (≠ S81), L84 (≠ H82), Y292 (≠ L274), R295 (= R277), N424 (≠ S406), N427 (≠ Q409), Q428 (≠ E410)
2o7eA Tyrosine ammonia-lyase from rhodobacter sphaeroides (his89phe variant), bound to 2-aminoindan-2-phosphonic acid (see paper)
33% identity, 89% coverage: 7:494/549 of query aligns to 8:514/515 of 2o7eA
- active site: Y54 (= Y52), G61 (= G59), L84 (≠ H82), N195 (= N191), Y292 (≠ L274), R295 (= R277), F342 (≠ A325), Q428 (≠ E410)
- binding (2-amino-2,3-dihydro-1h-inden-2-yl)phosphonic acid: Y54 (= Y52), G143 (= G140), L145 (= L142), N195 (= N191), Y292 (≠ L274), R295 (= R277), N325 (= N307), F342 (≠ A325)
P0DO55 Phenylalanine/tyrosine ammonia-lyase 1; FuPAL1; EC 4.3.1.25 from Fritillaria unibracteata (Sichuan fritillary) (see paper)
28% identity, 81% coverage: 10:451/549 of query aligns to 70:535/722 of P0DO55
- F141 (≠ I78) mutation to H: Increased activity toward L-tyrosine (L-Tyr) but reduced ability to use L-phenylalanine (L-Phe) as substrate.
- S208 (vs. gap) mutation to A: Higher binding affinity for L-phenylalanine (L-Phe) and decrease catalytic efficiency.
- I218 (= I148) mutation to P: Higher binding affinity for L-phenylalanine (L-Phe) and decrease catalytic efficiency.
- E490 (≠ L408) mutation to N: Higher binding affinity for L-phenylalanine (L-Phe) and decrease catalytic efficiency.
B2J528 Phenylalanine ammonia-lyase; EC 4.3.1.24 from Nostoc punctiforme (strain ATCC 29133 / PCC 73102) (see paper)
30% identity, 62% coverage: 27:364/549 of query aligns to 53:403/569 of B2J528
- A167 (≠ Y141) modified: Crosslink with 169, 5-imidazolinone (Ala-Gly)
- S168 (vs. gap) modified: 2,3-didehydroalanine (Ser)
- G169 (vs. gap) modified: Crosslink with 167, 5-imidazolinone (Ala-Gly)
6f6tB Phenylalanine ammonia-lyase (pal) from petroselinum crispum complexed with s-appa
28% identity, 81% coverage: 10:451/549 of query aligns to 41:492/677 of 6f6tB
6hqfA Structure of phenylalanine ammonia-lyase from petroselinum crispum in complex with (r)-apep
28% identity, 81% coverage: 10:451/549 of query aligns to 40:491/673 of 6hqfA
- active site: Y86 (= Y52), G93 (= G59), Y313 (≠ L274), F362 (≠ A325)
- binding [(1R)-1-amino-2-phenylethyl]phosphonic acid: Y86 (= Y52), F92 (≠ V58), G178 (= G140), L180 (= L142), N234 (= N191), N346 (= N307), F362 (≠ A325), E446 (≠ L408)
Q3M5Z3 Phenylalanine ammonia-lyase; EC 4.3.1.24 from Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) (see 2 papers)
29% identity, 66% coverage: 3:364/549 of query aligns to 26:403/567 of Q3M5Z3
- L108 (≠ H82) mutation to A: Slightly decreases catalytic rate.; mutation to G: Decreases catalytic rate.
- A167 (≠ Y141) modified: Crosslink with 169, 5-imidazolinone (Ala-Gly)
- S168 (vs. gap) modified: 2,3-didehydroalanine (Ser)
- G169 (vs. gap) modified: Crosslink with 167, 5-imidazolinone (Ala-Gly)
Sites not aligning to the query:
- 1:21 mutation Missing: No effect on enzyme activity.
- 503 C→S: Prevents formation of artifactual disulfide bonds and increases solubility; when associated with S-565.
- 565 C→S: Prevents formation of artifactual disulfide bonds and increases solubility; when associated with S-503.
5ltmB Crystal structure of phenylalanine ammonia-lyase from anabaena variabilis (y78f-c503s-c565s) bound to cinnamate (see paper)
28% identity, 87% coverage: 3:477/549 of query aligns to 2:502/537 of 5ltmB
- active site: F54 (≠ Y52), G61 (= G59), L84 (≠ H82), N197 (= N191), Y288 (≠ L274), R291 (= R277), F337 (≠ A325), Q426 (≠ H412)
- binding hydrocinnamic acid: F60 (≠ V58), A143 (≠ Y141), L145 (= L142), Y288 (≠ L274), R291 (= R277)
Query Sequence
>BPHYT_RS24020 FitnessBrowser__BFirm:BPHYT_RS24020
MAVIRSNRPLDWAQVAAVAAGEPLELSADARARIAAARVLVEQIVERGIRAYGVNTGVGA
LCDVVVSPGEQRTLSRNILMSHAVGVGAPLGAAETRAVMAAAVNNFAHGHSGIRLEVADQ
LVALLNADCLPEVPAFGSVGYLSHMAHIALVCIGEGYARLRGERITGRAALQRLGLEPLV
LEAKEGLSLVNGTPCVTGLAALALARAERLLDWTDMVASMSFENLRGQLAAFDEDSLALR
ISPGLNLVGGRMRAALADSGILAAVVGQRTQDPLSMRTIPHVHGAARDVLTATADVVNRE
LASITDNPIVAGTPEEPRVYSQAHAVGASIALAMDSLATAIAQVAAMAERRLDRLVNPLV
SGLPAFLAEPGGTCSGFMIAQYTAASLVAQNRRLALPASLDGGITSALQEDHLCHATPAA
LKALEIIDNAGRIVAIELLAAAQAYDLQSIDAPRAPHTGALWQRVRRVVPTYRDDRPLAD
DMSAAFRMIADEAPPPLPNPGKIGPRPLTSADGAATAAPATLANLAAAGHVRAAASIAVN
DGQAAAHIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory