SitesBLAST
Comparing BPHYT_RS24115 FitnessBrowser__BFirm:BPHYT_RS24115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
46% identity, 92% coverage: 1:256/278 of query aligns to 2:258/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S74), S110 (= S110), N111 (= N111), H112 (= H112), Y135 (= Y135), S164 (= S164), R173 (= R173), F257 (= F255)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G12 (= G11), Q13 (= Q12), L14 (= L13), D33 (≠ A32), L34 (≠ G33), D50 (= D50), L51 (= L51), L70 (≠ F70), G71 (≠ A71), G72 (= G72), S74 (= S74), A108 (= A108), S110 (= S110), Y135 (= Y135), K139 (= K139), I162 (= I162), S164 (= S164), C165 (= C165)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
46% identity, 92% coverage: 1:256/278 of query aligns to 1:257/265 of Q7CRQ0
- Y134 (= Y135) mutation to A: 0.1% of wild-type activity.
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
46% identity, 92% coverage: 1:256/278 of query aligns to 2:258/265 of 3rfxA
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
29% identity, 76% coverage: 3:212/278 of query aligns to 2:217/322 of 1r6dA
- active site: T127 (≠ S110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S74), H88 (vs. gap), T127 (≠ S110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), N180 (≠ E167), K190 (≠ H174), L191 (= L175), P206 (≠ T201), Y208 (≠ W203), R215 (= R210)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D37 (vs. gap), S38 (vs. gap), L39 (vs. gap), T40 (vs. gap), A42 (= A32), G43 (= G33), D63 (= D50), I64 (≠ L51), F83 (= F70), A84 (= A71), A85 (≠ G72), S87 (= S74), T102 (≠ N85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ R168)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
28% identity, 76% coverage: 3:212/278 of query aligns to 2:217/322 of 1r66A
- active site: T127 (≠ S110), D128 (≠ N111), E129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D37 (vs. gap), S38 (vs. gap), L39 (vs. gap), T40 (vs. gap), G43 (= G33), D63 (= D50), I64 (≠ L51), F83 (= F70), A84 (= A71), A85 (≠ G72), S87 (= S74), T102 (≠ N85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ R168)
- binding thymidine-5'-diphosphate: H88 (vs. gap), E129 (≠ H112), N180 (≠ E167), K190 (≠ H174), L191 (= L175), P206 (≠ T201), Y208 (≠ W203), R215 (= R210)
Sites not aligning to the query:
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
28% identity, 62% coverage: 2:172/278 of query aligns to 1:176/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Q11 (= Q12), I12 (≠ L13), D33 (≠ S34), I34 (≠ K35), R35 (≠ A36), L48 (≠ G49), D49 (= D50), V50 (≠ L51), A72 (= A71), A73 (≠ G72), L75 (vs. gap), P112 (≠ A108), S114 (= S110), Y139 (= Y135), K143 (= K139), Y166 (≠ I162), I169 (≠ C165)
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
30% identity, 57% coverage: 4:162/278 of query aligns to 3:160/328 of 4id9B
- active site: S107 (= S110), Y133 (= Y135), K137 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), R11 (≠ Q12), V12 (≠ L13), D31 (≠ K35), L32 (≠ A36), S45 (≠ D50), L46 (= L51), L65 (≠ F70), A67 (≠ G72), V82 (≠ N85), Y133 (= Y135), K137 (= K139), F160 (≠ I162)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
30% identity, 57% coverage: 4:162/278 of query aligns to 2:159/321 of 4id9A
- active site: S106 (= S110), Y132 (= Y135), K136 (= K139)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), R10 (≠ Q12), V11 (≠ L13), D30 (≠ K35), L31 (≠ A36), R32 (≠ L37), S44 (≠ D50), L45 (= L51), L64 (≠ F70), A66 (≠ G72), V81 (≠ N85), S106 (= S110), Y132 (= Y135), K136 (= K139), F159 (≠ I162)
Sites not aligning to the query:
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
27% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 2udpA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), S124 (= S110), Y149 (= Y135), K153 (= K139)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177
- binding phenyl-uridine-5'-diphosphate: 179, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
27% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 1udcA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-mannose: T126 (≠ H112), Y149 (= Y135)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-mannose: 179, 199, 200, 215, 216, 217, 218, 231, 233, 269, 292
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
27% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of P09147
- YI 11:12 (≠ QL 12:13) binding
- DNLCNS 31:36 (≠ RSAAGS 29:34) binding
- DI 58:59 (≠ DL 50:51) binding
- FAGLK 80:84 (≠ FAG-- 70:72) binding
- N99 (= N85) binding
- S124 (= S110) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y135) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K139) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
Sites not aligning to the query:
- 178 binding
- 299 Y→C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
27% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 1udaA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ H112)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: 179, 199, 200, 216, 217, 218, 231, 233, 292, 295, 299
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
27% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 1naiA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), Y149 (= Y135), K153 (= K139)
- binding 1,3-propandiol: N35 (≠ G33), K84 (vs. gap)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding 1,3-propandiol: 191, 193
- binding uridine-5'-diphosphate: 179, 199, 200, 215, 216, 231, 233, 292
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
27% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 1lrjA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), Y149 (= Y135), K153 (= K139)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (vs. gap), S124 (= S110)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-diphosphate-n-acetylglucosamine: 178, 179, 200, 215, 216, 218, 231, 233, 269, 292, 295
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
26% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 1kvrA
- active site: A124 (≠ S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), S123 (= S109), Y149 (= Y135), K153 (= K139)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate: 179, 198, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
26% identity, 51% coverage: 3:145/278 of query aligns to 2:159/338 of 1a9yA
- active site: A124 (≠ S110), A125 (≠ N111), T126 (≠ H112), F149 (≠ Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), S123 (= S109), F149 (≠ Y135), K153 (= K139)
- binding uridine-5'-diphosphate-glucose: A125 (≠ N111), T126 (≠ H112)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-glucose: 179, 199, 200, 216, 217, 218, 231, 233, 292, 295, 299
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
24% identity, 45% coverage: 47:172/278 of query aligns to 78:206/345 of Q7BJX9
Sites not aligning to the query:
- 26:31 binding
- 50:55 binding
- 213:216 binding
- 228:230 binding
- 236 S→G: No effect on epimerase activity.
- 237 binding
- 271 R→G: No effect on epimerase activity.
- 302:305 binding
- 307 R→A: No effect on epimerase activity.
- 308 H→A: No effect on epimerase activity.
- 309 S→Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
24% identity, 45% coverage: 47:172/278 of query aligns to 75:203/336 of 3ruhA
- active site: S142 (= S110), S143 (≠ N111), S144 (≠ H112), Y166 (= Y135), K170 (= K139)
- binding nicotinamide-adenine-dinucleotide: D78 (= D50), I79 (≠ L51), Q98 (≠ F70), A99 (= A71), A100 (≠ G72), T117 (≠ N85), A140 (= A108), A141 (≠ S109), S142 (= S110), Y166 (= Y135), K170 (= K139), Y193 (≠ I162), V196 (≠ C165)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (vs. gap), S103 (= S74), S142 (= S110), S143 (≠ N111), S144 (≠ H112), Y166 (= Y135), Y193 (≠ I162), N195 (≠ S164)
Sites not aligning to the query:
- active site: 204
- binding nicotinamide-adenine-dinucleotide: 23, 26, 27, 28, 47, 48, 50, 51, 52
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: 209, 210, 213, 214, 225, 226, 227, 234, 271, 294, 297, 298, 301
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
24% identity, 45% coverage: 47:172/278 of query aligns to 75:203/336 of 3rufA
- active site: S142 (= S110), S143 (≠ N111), S144 (≠ H112), Y166 (= Y135), K170 (= K139)
- binding nicotinamide-adenine-dinucleotide: D78 (= D50), I79 (≠ L51), Q98 (≠ F70), A99 (= A71), A100 (≠ G72), T117 (≠ N85), A140 (= A108), Y166 (= Y135), K170 (= K139), Y193 (≠ I162), V196 (≠ C165)
- binding uridine-5'-diphosphate: N195 (≠ S164)
Sites not aligning to the query:
- active site: 204
- binding nicotinamide-adenine-dinucleotide: 23, 26, 27, 28, 47, 48, 50, 51, 52
- binding uridine-5'-diphosphate: 209, 210, 213, 214, 225, 226, 227, 234, 271, 294, 297
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
24% identity, 45% coverage: 47:172/278 of query aligns to 75:203/336 of 3lu1A
- active site: S142 (= S110), S143 (≠ N111), S144 (≠ H112), Y166 (= Y135), K170 (= K139)
- binding glycine: Q135 (≠ K103), K187 (≠ E156)
- binding nicotinamide-adenine-dinucleotide: D78 (= D50), I79 (≠ L51), Q98 (≠ F70), A99 (= A71), A100 (≠ G72), A140 (= A108), A141 (≠ S109), S142 (= S110), Y166 (= Y135), K170 (= K139), Y193 (≠ I162), N195 (≠ S164)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S74), S142 (= S110), S143 (≠ N111), S144 (≠ H112), Y166 (= Y135), N195 (≠ S164)
Sites not aligning to the query:
- active site: 204
- binding nicotinamide-adenine-dinucleotide: 23, 26, 27, 28, 47, 48, 50, 51, 52
- binding uridine-diphosphate-n-acetylgalactosamine: 210, 214, 225, 226, 227, 234, 271, 294, 297
Query Sequence
>BPHYT_RS24115 FitnessBrowser__BFirm:BPHYT_RS24115
MKKIALSGAGGQLGSVVRAALIARGTPLRSAAGSKALVPLVDGEDVMHGDLRDPAVVDRL
LEGVDVLIHFAGTSVERPLPEIIENNLRGLVEVYEGARRQGVKRIVFASSNHAIGMYPVT
EHLSLDCELRPDGFYGLSKVWGEALARMYWDKHGIESVCVRIGSCLERPTEPRHLSTWFG
HRDLLHFLDRCVEAENVGFLTIWGVSANTRSWWDNSGAERLGYQPTQDAEVYAEEILARP
NPLDALGQRFQGGSFVGIDYSRDDAAADGSAASATRPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory