Comparing BPHYT_RS24155 FitnessBrowser__BFirm:BPHYT_RS24155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
54% identity, 98% coverage: 4:301/305 of query aligns to 3:298/310 of 5hwnB
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
54% identity, 98% coverage: 4:301/305 of query aligns to 3:298/304 of 4ur8A
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
27% identity, 93% coverage: 20:303/305 of query aligns to 10:292/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
27% identity, 93% coverage: 20:303/305 of query aligns to 10:292/296 of 7lvlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 95% coverage: 13:303/305 of query aligns to 3:289/292 of Q07607
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
28% identity, 93% coverage: 20:303/305 of query aligns to 10:291/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
28% identity, 77% coverage: 20:254/305 of query aligns to 10:244/294 of 4i7wA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
28% identity, 94% coverage: 15:302/305 of query aligns to 8:292/295 of 5ktlA
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
32% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 6u01B
Sites not aligning to the query:
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
32% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 4m19A
Sites not aligning to the query:
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
32% identity, 55% coverage: 14:181/305 of query aligns to 16:186/306 of 7kkdB
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
32% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 7kg2A
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
28% identity, 81% coverage: 41:288/305 of query aligns to 34:281/299 of 5ud6C
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
30% identity, 69% coverage: 20:228/305 of query aligns to 10:217/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
30% identity, 69% coverage: 20:228/305 of query aligns to 10:217/292 of 3puoA
Sites not aligning to the query:
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
26% identity, 93% coverage: 20:303/305 of query aligns to 10:290/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
26% identity, 93% coverage: 20:303/305 of query aligns to 10:290/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
26% identity, 93% coverage: 20:303/305 of query aligns to 11:291/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
25% identity, 93% coverage: 20:303/305 of query aligns to 10:290/292 of 3i7sA
Sites not aligning to the query:
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
24% identity, 93% coverage: 20:303/305 of query aligns to 11:293/295 of 1o5kA
>BPHYT_RS24155 FitnessBrowser__BFirm:BPHYT_RS24155
MTTPQELKQIVSEGLLSFPVTDFDEQGDFRADTYAERLEWLAPYGASALFVAGGTGEFFS
LTHNDYSNVVKTATEVCKGKVPILAGAGGPTRVAIAYAQEAERHGANGILLMPHYLTEAC
QEGIAAHAEEVCKSVPNMGVIIYNRANSKLNADMLEGLAERCPNLIGFKDGVGEIENMVS
IRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHATV
GKLIDEFFLPYLAIRNRRAGYAVSIVKAGAKLVGHSAGPVRAPLTDLTEEEMGKLDALIK
TLGPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory