SitesBLAST
Comparing BPHYT_RS24165 FitnessBrowser__BFirm:BPHYT_RS24165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
49% identity, 92% coverage: 15:271/280 of query aligns to 1:257/265 of Q7CRQ0
- Y134 (= Y148) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
49% identity, 92% coverage: 15:271/280 of query aligns to 2:258/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S87), S110 (= S123), N111 (= N124), H112 (= H125), Y135 (= Y148), S164 (= S177), R173 (= R186), F257 (= F270)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G22), G12 (= G25), Q13 (≠ N26), L14 (= L27), D33 (= D46), L34 (≠ I47), D50 (= D63), L51 (≠ I64), L70 (= L83), G71 (= G84), G72 (= G85), S74 (= S87), A108 (= A121), S110 (= S123), Y135 (= Y148), K139 (= K152), I162 (= I175), S164 (= S177), C165 (≠ S178)
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
49% identity, 92% coverage: 15:271/280 of query aligns to 2:258/265 of 3rfxA
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
36% identity, 56% coverage: 18:175/280 of query aligns to 2:159/321 of 4id9A
- active site: S106 (= S123), Y132 (= Y148), K136 (= K152)
- binding nicotinamide-adenine-dinucleotide: G9 (= G25), R10 (≠ N26), V11 (≠ L27), D30 (= D46), L31 (≠ I47), R32 (≠ A48), S44 (≠ D63), L45 (≠ I64), L64 (= L83), A66 (≠ G85), V81 (≠ A98), S106 (= S123), Y132 (= Y148), K136 (= K152), F159 (≠ I175)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
36% identity, 56% coverage: 18:175/280 of query aligns to 3:160/328 of 4id9B
- active site: S107 (= S123), Y133 (= Y148), K137 (= K152)
- binding nicotinamide-adenine-dinucleotide: G10 (= G25), R11 (≠ N26), V12 (≠ L27), D31 (= D46), L32 (≠ I47), S45 (≠ D63), L46 (≠ I64), L65 (= L83), A67 (≠ G85), V82 (≠ A98), Y133 (= Y148), K137 (= K152), F160 (≠ I175)
Sites not aligning to the query:
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
29% identity, 57% coverage: 16:174/280 of query aligns to 1:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Q11 (≠ N26), I12 (≠ L27), D33 (= D46), I34 (= I47), R35 (≠ A48), L48 (≠ V62), D49 (= D63), V50 (≠ I64), A72 (≠ G84), A73 (≠ G85), L75 (vs. gap), P112 (≠ A121), S114 (= S123), Y139 (= Y148), K143 (= K152)
Sites not aligning to the query:
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 56% coverage: 18:174/280 of query aligns to 2:163/311 of 3a4vA
- active site: T112 (≠ S123), Y137 (= Y148), K141 (= K152)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (= D40), I33 (= I41), L46 (≠ V62), D47 (= D63), V48 (≠ I64), L69 (= L83), A70 (≠ G84), G71 (= G85), L73 (≠ S87), P110 (≠ A121), S111 (= S122), T112 (≠ S123), Y137 (= Y148), K141 (= K152)
- binding pyruvic acid: S74 (≠ V88), Y137 (= Y148)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 56% coverage: 18:174/280 of query aligns to 2:163/315 of 3a1nA
- active site: T112 (≠ S123), Y137 (= Y148), K141 (= K152)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (= D40), I33 (= I41), L46 (≠ V62), D47 (= D63), L69 (= L83), A70 (≠ G84), G71 (= G85), L73 (≠ S87), S111 (= S122), Y137 (= Y148), K141 (= K152)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 60% coverage: 17:185/280 of query aligns to 2:180/307 of 6wjaA
- active site: A118 (≠ S123), A119 (≠ N124), A120 (≠ H125), F143 (≠ Y148), K147 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (≠ N26), I12 (≠ L27), D31 (= D46), D32 (≠ I47), S34 (≠ P49), T35 (≠ L50), G36 (= G51), A55 (≠ I64), L74 (= L83), A75 (≠ G84), A76 (≠ G85), S93 (≠ A98), F143 (≠ Y148), K147 (= K152), F170 (≠ I175), F171 (≠ G176), I173 (≠ S178)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V88), A120 (≠ H125), N172 (≠ S177)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 60% coverage: 17:185/280 of query aligns to 3:181/308 of 6wj9B
- active site: A119 (≠ S123), A120 (≠ N124), A121 (≠ H125), F144 (≠ Y148), K148 (= K152)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (≠ N26), I13 (≠ L27), D32 (= D46), D33 (≠ I47), S35 (≠ P49), T36 (≠ L50), G37 (= G51), D55 (= D63), A56 (≠ I64), L75 (= L83), A76 (≠ G84), A77 (≠ G85), S94 (≠ A98), A117 (= A121), A119 (≠ S123), F144 (≠ Y148), K148 (= K152), F171 (≠ I175), F172 (≠ G176), I174 (≠ S178)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V88), N173 (≠ S177)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 56% coverage: 18:174/280 of query aligns to 2:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (= D40), I33 (= I41), L46 (≠ V62), D47 (= D63), V48 (≠ I64), L69 (= L83), A70 (≠ G84), G71 (= G85), L73 (≠ S87), P110 (≠ A121), S111 (= S122), T112 (≠ S123), F137 (≠ Y148), K141 (= K152)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ V88), T112 (≠ S123), I113 (≠ N124), F137 (≠ Y148)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
28% identity, 56% coverage: 18:174/280 of query aligns to 2:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (= D40), I33 (= I41), L46 (≠ V62), D47 (= D63), V48 (≠ I64), L69 (= L83), A70 (≠ G84), L73 (≠ S87), V87 (≠ A98), P110 (≠ A121), S111 (= S122), K141 (= K152)
- binding threonine: S74 (≠ V88), T112 (≠ S123), F137 (≠ Y148)
Sites not aligning to the query:
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
30% identity, 57% coverage: 18:177/280 of query aligns to 2:164/290 of 3eheA
- active site: T111 (≠ S123), S112 (≠ N124), T113 (≠ H125), Y135 (= Y148), K139 (= K152)
- binding nicotinamide-adenine-dinucleotide: G6 (= G22), G9 (= G25), F10 (≠ N26), I11 (≠ L27), D29 (≠ T45), N30 (≠ D46), L31 (≠ I47), S32 (≠ A48), S33 (≠ P49), G34 (≠ L50), D49 (= D66), L50 (≠ E67), I68 (≠ L83), A69 (≠ G84), A70 (≠ G85), T109 (≠ A121), Y135 (= Y148), K139 (= K152), F162 (≠ I175), A163 (≠ G176), N164 (≠ S177)
Sites not aligning to the query:
6jygD Crystal structure of l-threonine dehydrogenase from phytophthora infestans (see paper)
31% identity, 56% coverage: 17:174/280 of query aligns to 2:162/307 of 6jygD
- binding citrate anion: Q11 (≠ N26), L73 (≠ S87), S74 (≠ V88), Y136 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), T9 (≠ A24), G10 (= G25), Q11 (≠ N26), I12 (≠ L27), D33 (= D46), I34 (= I47), K35 (≠ A48), D47 (≠ S60), V48 (≠ I61), M69 (≠ L83), A70 (≠ G84), S71 (≠ G85), L73 (≠ S87), V87 (≠ A98), P109 (≠ S122), S110 (= S123), T111 (≠ N124), Y136 (= Y148), K140 (= K152)
Sites not aligning to the query:
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
27% identity, 61% coverage: 17:187/280 of query aligns to 3:189/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (≠ N26), I13 (≠ L27), D32 (≠ T45), N33 (≠ D46), N35 (≠ A48), Y38 (≠ G51), K43 (≠ H56), D61 (= D63), L62 (≠ I64), L83 (= L83), A84 (≠ G84), A85 (vs. gap), A123 (= A121), Y150 (= Y148), K154 (= K152), F177 (≠ I175), V180 (≠ S178), R186 (≠ N184), M189 (= M187)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
29% identity, 62% coverage: 17:189/280 of query aligns to 2:192/322 of 1r6dA
- active site: T127 (≠ S123), N128 (= N124), Q129 (≠ H125), Y151 (= Y148), K155 (= K152)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S87), H88 (vs. gap), T127 (≠ S123), N128 (= N124), Q129 (≠ H125), Y151 (= Y148), N180 (≠ S177), K190 (≠ M187), L191 (= L188)
- binding nicotinamide-adenine-dinucleotide: G10 (= G25), F11 (≠ N26), I12 (≠ L27), D37 (= D46), S38 (≠ I47), L39 (vs. gap), T40 (vs. gap), A42 (vs. gap), G43 (vs. gap), D63 (= D63), I64 (= I64), F83 (≠ L83), A84 (≠ G84), A85 (≠ G85), S87 (= S87), T102 (≠ A98), V125 (≠ A121), S126 (= S122), Y151 (= Y148), K155 (= K152), N181 (≠ S178)
Sites not aligning to the query:
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
30% identity, 58% coverage: 18:179/280 of query aligns to 18:190/336 of 6pnlA
- active site: S133 (= S123), C135 (≠ H125), G136 (≠ A126), Y159 (= Y148), K163 (= K152)
- binding nicotinamide-adenine-dinucleotide: G22 (= G22), G25 (= G25), C26 (≠ N26), D46 (≠ T45), N47 (≠ D46), L48 (≠ I47), S49 (≠ A48), S50 (≠ P49), S51 (≠ L50), D68 (= D63), I69 (= I64), L89 (= L83), A91 (≠ G85), F93 (vs. gap), V108 (≠ A98), S131 (≠ A121), S133 (= S123), Y159 (= Y148), K163 (= K152), F186 (≠ I175), N188 (≠ S177), V189 (≠ S178)
- binding uridine-5'-diphosphate: N188 (≠ S177)
Sites not aligning to the query:
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
30% identity, 58% coverage: 18:179/280 of query aligns to 12:184/330 of 6pmhA
- active site: S127 (= S123), C129 (≠ H125), G130 (≠ A126), Y153 (= Y148), K157 (= K152)
- binding adenosine monophosphate: G16 (= G22), G19 (= G25), D40 (≠ T45), N41 (≠ D46), S43 (≠ A48), S44 (≠ P49), S45 (≠ L50), D62 (= D63), I63 (= I64), A84 (≠ G84), F87 (vs. gap)
- binding uridine-5'-diphosphate: C129 (≠ H125), N182 (≠ S177)
Sites not aligning to the query:
2q1wA Crystal structure of the bordetella bronchiseptica enzyme wbmh in complex with NAD+ (see paper)
29% identity, 58% coverage: 15:177/280 of query aligns to 1:168/300 of 2q1wA
- active site: S54 (vs. gap), L60 (≠ A69), T117 (≠ S123), Y143 (= Y148), K147 (= K152)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), Q12 (≠ N26), I13 (≠ L27), D32 (= D46), N33 (≠ I47), F34 (≠ A48), A35 (≠ P49), T36 (≠ L50), G37 (= G51), S54 (vs. gap), I55 (= I64), T76 (≠ L83), A77 (≠ G84), A78 (≠ G85), Y80 (≠ V88), T92 (≠ A98), F115 (≠ A121), Y143 (= Y148), K147 (= K152), N168 (≠ S177)
Sites not aligning to the query:
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
26% identity, 61% coverage: 17:187/280 of query aligns to 3:184/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (≠ N26), I13 (≠ L27), D32 (≠ T45), N33 (≠ D46), N35 (≠ A48), Y38 (≠ G51), K43 (≠ H56), D61 (= D63), L62 (≠ I64), L83 (= L83), A84 (≠ G84), A85 (≠ G85), A118 (= A121), Y145 (= Y148), K149 (= K152), F172 (≠ I175), F173 (≠ G176), T174 (≠ S177), V175 (≠ S178), R181 (≠ N184)
Query Sequence
>BPHYT_RS24165 FitnessBrowser__BFirm:BPHYT_RS24165
MTDSNLDRSAAQKPFRRLLLTGAAGNLGKQLRGALAAWADIVRITDIAPLGEVAAHEEAS
IVDIADEAAVHALLEGVDAVVHLGGISVEAPFEDLLQANIRGLYNLYSAAQKQGVKRIVY
ASSNHAVGFHPVTEVVDIDAPLRPDSLYGVTKCFGESLSRYYFDRFGLETVCLRIGSSFE
QPKNPRMLVTYLSFRDLIELVRCSLFTNRVGHAIVYGVSDNRTKWVDNTKAAFLGFRPQD
SSVEFEHLFPVTAPTADLDDPTQRFQGGPFVLAGPMEPKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory