SitesBLAST
Comparing BPHYT_RS24640 FitnessBrowser__BFirm:BPHYT_RS24640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
46% identity, 99% coverage: 1:421/426 of query aligns to 14:436/478 of Q47945
- Q37 (≠ R25) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
47% identity, 93% coverage: 27:421/426 of query aligns to 1:398/433 of 8gy2B
- binding heme c: C18 (= C44), C21 (= C47), H22 (= H48), T46 (= T72), I48 (= I74), Y59 (= Y85), L68 (≠ M94), R73 (≠ A99), V79 (≠ L105), Y80 (= Y106), M83 (= M109), F88 (≠ Y114), R126 (= R152), H165 (= H190), C166 (= C191), C169 (= C194), H170 (= H195), I201 (≠ F224), A202 (= A225), P203 (≠ A226), L205 (= L228), W216 (= W239), F224 (= F247), A234 (≠ S257), V235 (≠ A258), F236 (= F259), F236 (= F259), M239 (= M262), N301 (≠ Y325), C302 (= C326), C305 (= C329), H306 (= H330), M316 (= M340), F317 (≠ L341), P318 (≠ A342), L320 (= L344), P324 (= P348), G342 (≠ T366), S352 (≠ A376), V354 (≠ Y378), M356 (= M380), F359 (≠ Y383), M375 (≠ V399)
- binding ubiquinone-10: C21 (= C47), L34 (= L60), P39 (= P65), P81 (= P107), L129 (= L155), W132 (= W158), E168 (≠ S193), R173 (= R198), I197 (≠ L220), D241 (≠ S264)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
40% identity, 91% coverage: 32:419/426 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C44), C16 (= C47), H17 (= H48), T42 (= T72), I44 (= I74), Y55 (= Y85), L75 (= L105), Y76 (= Y106), A78 (= A108), M79 (= M109), R122 (= R152), H161 (= H190), C162 (= C191), C165 (= C194), H166 (= H195), A191 (= A225), P192 (≠ A226), R223 (≠ S257), P227 (≠ S261), M228 (= M262), V289 (≠ Y325), C290 (= C326), C293 (= C329), H294 (= H330), Y305 (≠ L341), Y306 (≠ A342), P307 (= P343), L309 (= L344), N312 (= N347), T313 (≠ P348), T314 (≠ N349), D322 (≠ S357), I327 (≠ T362), V331 (vs. gap), R333 (vs. gap), I340 (≠ G372), M342 (≠ I374), P343 (= P375), F345 (≠ P377)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
39% identity, 91% coverage: 32:419/426 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C44), C16 (= C47), H17 (= H48), T42 (= T72), I44 (= I74), F60 (= F90), L64 (≠ M94), L75 (= L105), Y76 (= Y106), M79 (= M109), P80 (= P110), Y84 (= Y114), R122 (= R152), C162 (= C191), C165 (= C194), H166 (= H195), I186 (≠ L220), W189 (= W223), A191 (= A225), P192 (≠ A226), I194 (≠ L228), W205 (= W239), Y213 (≠ F247), R223 (≠ S257), M228 (= M262), V303 (≠ Y325), C304 (= C326), C307 (= C329), H308 (= H330), Y320 (≠ A342), P321 (= P343), L323 (= L344), T327 (≠ P348), T328 (≠ N349), D336 (≠ S357), I341 (≠ T362), V345 (≠ T366), R347 (≠ D368), I354 (vs. gap), M356 (≠ I374), F359 (≠ P377), I376 (≠ V395)
- binding ubiquinone-10: M36 (= M66), P77 (= P107), S124 (≠ P154), W128 (= W158), C165 (= C194), L173 (= L207)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 87% coverage: 32:400/426 of query aligns to 41:408/440 of 8gy3A
- binding heme c: Y52 (≠ D43), C53 (= C44), C56 (= C47), H57 (= H48), S84 (≠ T72), I86 (= I74), W97 (≠ Y85), F102 (= F90), L117 (= L105), F121 (≠ M109), F126 (≠ Y114), R163 (= R152), C203 (= C191), C206 (= C194), H207 (= H195), A232 (= A225), P233 (≠ A226), L235 (= L228), W245 (= W239), Y253 (≠ F247), L254 (= L248), G263 (≠ A256), S264 (= S257), M269 (= M262), Y292 (≠ L285), C337 (= C326), C340 (= C329), H341 (= H330), P353 (≠ A342), L355 (= L344), N358 (= N347), N359 (≠ P348), V372 (= V361), I377 (≠ T366), G382 (vs. gap), Q383 (≠ E367), I386 (≠ V370), M388 (= M380), F391 (≠ Y383)
- binding ubiquinone-10: E55 (≠ A46), T76 (= T64), F78 (≠ M66), Y118 (= Y106), P119 (= P107), I160 (≠ L149), G166 (≠ L155), Q167 (≠ K156), F169 (= F157), W170 (= W158), H202 (= H190), R210 (= R198), L213 (≠ A201)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
39% identity, 24% coverage: 319:419/426 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C326), C33 (= C329), H34 (= H330), Y46 (≠ A342), P47 (= P343), T54 (≠ N349), V66 (= V361), I67 (≠ T362), R73 (≠ D368), I80 (= I371), M82 (= M380), P83 (= P381)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
33% identity, 30% coverage: 294:419/426 of query aligns to 313:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C326), C350 (= C329), H351 (= H330), F362 (≠ L341), P363 (≠ A342), P364 (= P343), L365 (= L344), S368 (≠ P348), Y370 (≠ V350), I382 (≠ T362), L386 (≠ T366), S387 (≠ E367), G388 (≠ D368), I390 (≠ L369), V392 (≠ I371), Y397 (≠ A376), N398 (≠ P377), G399 (≠ Y378), V400 (≠ P379), M401 (= M380)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 24% coverage: 317:419/426 of query aligns to 352:453/456 of 5oboA
- binding heme c: T360 (≠ Y325), C361 (= C326), C364 (= C329), H365 (= H330), P377 (≠ A342), P378 (= P343), L379 (= L344), S382 (≠ N347), F384 (≠ V350), I395 (≠ V361), N401 (≠ E367), G402 (vs. gap), S413 (≠ Y378), M415 (= M380), M418 (≠ Y383)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
32% identity, 24% coverage: 317:419/426 of query aligns to 354:455/457 of 4ax3D
- binding heme c: C363 (= C326), C366 (= C329), H367 (= H330), P379 (≠ A342), P380 (= P343), L381 (= L344), S384 (≠ N347), F386 (≠ V350), N403 (≠ E367), G404 (vs. gap), S415 (≠ Y378), M417 (= M380), M420 (≠ Y383)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 24% coverage: 317:419/426 of query aligns to 351:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ Y325), C360 (= C326), C363 (= C329), H364 (= H330), P376 (≠ A342), P377 (= P343), L378 (= L344), F383 (≠ V350), N400 (≠ E367), G401 (vs. gap), Y410 (≠ A376), S412 (≠ Y378), M414 (= M380), M417 (≠ Y383)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
Query Sequence
>BPHYT_RS24640 FitnessBrowser__BFirm:BPHYT_RS24640
MKNTLKGFGAALCLTLPLFAQTPARAADQALVQRGAYLAKAGDCVACHTAPKGKPFAGGL
PMTTPMGQIYTTNITPDPQTGIGGYTEEDFARAMREGVAKDGHNLYPAMPYPSYAKVNDD
DMKALYAYFMSGVAPVQQANREPDIKWPLNMRWPLKFWNMVFLDKGVYQDKPGKDVAWNR
GAYLIQGLGHCGSCHTPRGIAFQEKALDESGSAFLTGGLLDGWFAANLTGEHNVGLGRWN
DQDLQAFLKTGANRHASAFGSMTSVINNSTQGLNDTDIAAMSTYLKSLPPAGGSGAPPYK
YDPQATKVSLNRPANDAGARVYTAYCMHCHGVDGRGFAPMLAPLSGNPNVLEKDPSSLIN
VTLNGTEDLVIGGIPAPYPMPKYAPVLNDQQIADVLTFVRAGWNNGAPAVTADDVAKLRK
STHAAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory