SitesBLAST
Comparing BPHYT_RS24765 FitnessBrowser__BFirm:BPHYT_RS24765 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
41% identity, 100% coverage: 4:830/831 of query aligns to 21:823/824 of Q8GAI3
- W66 (= W49) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H50) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
35% identity, 94% coverage: 9:786/831 of query aligns to 50:818/866 of Q9UI17
- CV 59:60 (≠ II 18:19) binding
- EK 80:81 (≠ EQ 39:40) binding
- 87:95 (vs. 46:54, 89% identical) binding
- H91 (= H50) modified: Tele-8alpha-FAD histidine
- H109 (≠ I68) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V178) binding
- S279 (≠ A252) to P: in dbSNP:rs532964
- FG-YGII 397:402 (≠ FNSMGIA 362:368) binding
- A530 (= A497) to G: in dbSNP:rs1805073
- S646 (≠ K613) to P: in dbSNP:rs1805074
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 94% coverage: 9:786/831 of query aligns to 43:811/857 of Q63342
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
34% identity, 94% coverage: 9:786/831 of query aligns to 6:774/824 of 4pabB
- active site: T53 (≠ G56), E102 (≠ Q105), H226 (= H243), Y255 (= Y269), E536 (≠ D548)
- binding flavin-adenine dinucleotide: I11 (≠ V14), G12 (= G15), G14 (= G17), C15 (≠ I18), V16 (≠ I19), L35 (= L38), E36 (= E39), K37 (≠ Q40), G43 (= G46), S44 (≠ T47), T45 (= T48), H47 (= H50), A48 (= A51), A49 (= A52), G50 (= G53), L51 (= L54), V175 (= V178), A204 (= A221), G205 (= G222), W207 (= W224), H226 (= H243), Y228 (= Y245), G326 (= G335), I328 (≠ E337), F353 (= F362), Y355 (≠ M365), G356 (= G366), I357 (= I367), I358 (≠ A368)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y535), E536 (≠ D548), T538 (= T550), I550 (≠ V562), F612 (= F623), L613 (≠ G624), Y632 (= Y643), E639 (= E650), F680 (≠ Y691), Y700 (≠ F711)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
30% identity, 99% coverage: 10:830/831 of query aligns to 6:829/830 of Q9AGP8
- IV 14:15 (≠ II 18:19) binding
- DQ 35:36 (≠ EQ 39:40) binding
- STSH 45:48 (≠ TTWH 47:50) binding
- L52 (= L54) binding
- V174 (= V178) binding
- H225 (= H243) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y269) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ MGIA 365:368) binding
- Y539 (= Y535) binding
- D552 (= D548) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
30% identity, 99% coverage: 10:830/831 of query aligns to 4:827/828 of 1pj6A
- active site: H223 (= H243), Y257 (= Y269), D550 (= D548)
- binding flavin-adenine dinucleotide: G9 (= G15), G11 (= G17), I12 (= I18), V13 (≠ I19), D33 (≠ E39), Q34 (= Q40), G42 (= G46), S43 (≠ T47), T44 (= T48), H46 (= H50), P48 (≠ A52), L50 (= L54), V172 (= V178), A201 (= A221), G202 (= G222), W204 (= W224), H223 (= H243), Y257 (= Y269), G331 (= G335), I332 (≠ P336), V358 (≠ M365), W359 (≠ G366), V360 (≠ I367), T361 (≠ A368)
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
30% identity, 99% coverage: 10:830/831 of query aligns to 3:826/827 of 1pj7A
- active site: H222 (= H243), Y256 (= Y269), D549 (= D548)
- binding flavin-adenine dinucleotide: G8 (= G15), G10 (= G17), I11 (= I18), V12 (≠ I19), D32 (≠ E39), Q33 (= Q40), G41 (= G46), S42 (≠ T47), T43 (= T48), H45 (= H50), P47 (≠ A52), L49 (= L54), T170 (≠ R177), V171 (= V178), A200 (= A221), G201 (= G222), W203 (= W224), H222 (= H243), Y256 (= Y269), I331 (≠ P336), V357 (≠ M365), W358 (≠ G366), V359 (≠ I367), T360 (≠ A368)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F504), Y536 (= Y535), D549 (= D548), T551 (= T550), G563 (≠ V562), F629 (≠ G624), Y648 (= Y643), E655 (= E650), Y696 (= Y691)
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
30% identity, 99% coverage: 10:830/831 of query aligns to 3:826/827 of 3gsiA
- active site: H222 (= H243), Y256 (= Y269), A549 (≠ D548)
- binding flavin-adenine dinucleotide: G10 (= G17), I11 (= I18), V12 (≠ I19), D32 (≠ E39), Q33 (= Q40), G41 (= G46), S42 (≠ T47), T43 (= T48), H45 (= H50), P47 (≠ A52), L49 (= L54), T170 (≠ R177), V171 (= V178), A200 (= A221), G201 (= G222), W203 (= W224), H222 (= H243), Y256 (= Y269), G330 (= G335), I331 (≠ P336), F332 (≠ E337), V357 (≠ M365), W358 (≠ G366), V359 (≠ I367), T360 (≠ A368)
- binding magnesium ion: D254 (≠ F267), V409 (≠ G417)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F504), Y536 (= Y535), T551 (= T550), G563 (≠ V562), F629 (≠ G624), Y648 (= Y643), E655 (= E650), Y696 (= Y691)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
30% identity, 43% coverage: 435:794/831 of query aligns to 1:334/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
30% identity, 43% coverage: 435:794/831 of query aligns to 1:334/362 of 1wopA
- active site: D96 (= D548)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F504), L55 (= L508), Y83 (= Y535), D96 (= D548), V98 (≠ T550), E106 (≠ Q558), L108 (= L560), V110 (= V562), N112 (≠ G564), I137 (≠ V590), E160 (≠ K613), Y168 (≠ A622), Y169 (≠ F623), K173 (≠ R627), S174 (≠ E628), I175 (≠ L629), E180 (≠ A634), T181 (= T635), Y188 (= Y643), E195 (= E650), M197 (≠ Y652), R227 (≠ I682), Y236 (= Y691)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
30% identity, 43% coverage: 435:794/831 of query aligns to 1:334/362 of 1wooA
- active site: D96 (= D548)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F504), Y83 (= Y535), D96 (= D548), V98 (≠ T550), V110 (= V562), N112 (≠ G564), Y168 (≠ A622), Y169 (≠ F623), Y188 (= Y643), E195 (= E650), Y236 (= Y691)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
25% identity, 45% coverage: 24:400/831 of query aligns to 20:370/374 of 1y56B
- active site: F44 (≠ W49), G47 (≠ A52), T48 (≠ G53), H224 (= H243), P239 (≠ L258), G305 (= G335), M338 (≠ A368)
- binding flavin-adenine dinucleotide: I33 (≠ L38), E34 (= E39), K35 (≠ Q40), S42 (≠ T47), T43 (= T48), R45 (≠ H50), C46 (≠ A51), G47 (≠ A52), G49 (≠ L54), E170 (≠ R177), V171 (= V178), T200 (≠ A221), N201 (≠ G222), W203 (= W224), G305 (= G335), Y306 (≠ P336), Y307 (≠ E337), G334 (≠ S364), H335 (≠ M365), G336 (= G366), F337 (≠ I367), M338 (≠ A368)
- binding flavin mononucleotide: F44 (≠ W49), R45 (≠ H50), I260 (≠ M279), R301 (≠ Q331), W303 (≠ Y333)
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
29% identity, 43% coverage: 434:788/831 of query aligns to 575:930/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
29% identity, 35% coverage: 430:718/831 of query aligns to 569:852/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
28% identity, 34% coverage: 434:718/831 of query aligns to 572:851/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
28% identity, 34% coverage: 434:718/831 of query aligns to 572:851/963 of 1vrqA
- active site: D676 (= D548)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F504), Y663 (= Y535), G677 (≠ F549), H690 (≠ V562), I774 (≠ L641), F776 (≠ Y643), E783 (= E650), K822 (= K689), F824 (≠ Y691)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
28% identity, 34% coverage: 434:718/831 of query aligns to 573:852/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 47% coverage: 12:398/831 of query aligns to 23:387/403 of 2gagB
- active site: A61 (≠ W49), T64 (≠ A52), T65 (≠ G53)
- binding flavin-adenine dinucleotide: G26 (= G15), G28 (= G17), G29 (≠ I18), H30 (≠ I19), E51 (= E39), K52 (≠ Q40), G58 (= G46), N59 (≠ T47), M60 (≠ T48), R62 (≠ H50), N63 (≠ A51), T64 (≠ A52), I66 (≠ L54), V195 (= V178), G224 (≠ A221), A225 (≠ G222), H227 (≠ W224), L231 (≠ V228), L246 (≠ H243), G352 (≠ N363), T353 (≠ S364), G354 (≠ M365), G355 (= G366), F356 (≠ I367), K357 (≠ A368)
- binding flavin mononucleotide: A61 (≠ W49), R62 (≠ H50), H171 (≠ P154), V250 (= V247), E278 (≠ G276), R321 (≠ Q331), W323 (≠ Y333)
- binding 2-furoic acid: T64 (≠ A52), I66 (≠ L54), R68 (≠ G56), M263 (= M261), Y270 (≠ I268), K357 (≠ A368)
- binding sulfite ion: K170 (≠ N153), K276 (≠ V274)
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
27% identity, 42% coverage: 435:786/831 of query aligns to 2:334/371 of 1wsvA
- active site: D98 (= D548)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ F504), L85 (≠ V534), D98 (= D548), L99 (≠ F549), I100 (≠ T550), V112 (= V562), N114 (≠ G564), F173 (= F621), G193 (≠ T642), Y194 (= Y643), E201 (= E650), R230 (≠ I682), L239 (≠ Y691)
Sites not aligning to the query:
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
27% identity, 44% coverage: 423:786/831 of query aligns to 20:365/403 of P48728
- D129 (= D548) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ G564) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E650) binding
- R261 (≠ I682) binding
- G269 (= G690) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ M739) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
Query Sequence
>BPHYT_RS24765 FitnessBrowser__BFirm:BPHYT_RS24765
MSTPLPTHARVVIVGGGIIGCSVAYHLTKLGWTDVVLLEQGQLSCGTTWHAAGLVGQLRA
QESMTKLIRYSTALYAELEADTGLATGWKQCGSLSVARTAERMTQLKRTAAVARAYGVAC
DVISPREAGDLWPVMRTDDLLGAVWLPGDGKANPTDLTQALARGARQRGARIVENTRVTA
IHTRTAQDGKANGAREVSGLAWRNKDGEEGTLGADIVVNCAGQWAKGVGRLCGVTVPLHS
AEHYYIVTERIAGVHPDLPVMRDPDGFIYFKEEVGGLVMGGFEPDAKPWGMNGIPENFEF
QLLPDDWDQFEILMKNALQRVPALETAQVKQFYNGPESFTPDNNFMLGEAPELRRFFVGA
GFNSMGIASAGGAGMALAEWIVAGEPTMDLWPVDIRRFARFNGNDTWLHDRVKETLGLHY
AMPWPNRELDSARPFRRSPLYSLLRDEGACFGSKMGWERANFFAPSPDEARIEYAFGQQN
WLPWSGAEHRACREGVALFDMTSFSKFLVKGRDAQSVLQGLVANDVDVPNGTTVYTAMLN
ERGGYESDFTLTRLADDQYLLVTGTAQTTRDFDSIEKSIPHDRHCTLVDVTGQYAVLAVM
GPRSRELLQSVSKADWSNEAFAFGQSRELDLGYATVRATRLTYVGELGWELYVPVEFAVG
VYETLHAAGKAFGLVNAGYYAIDSLRIEKGYRAWGRELTPDTNPFEAGLSFACKLDKDIA
FRGRDALLKLRAEPLRRRMVVLSANGATDRMLWGGEAILRDGKPVGFVSSAAFGHTLGCP
VAMGYVNNPDGAADAEYLNSGSYAIDVAGELLPATLHLKAPYDPRSERVKC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory