SitesBLAST
Comparing BPHYT_RS25360 FitnessBrowser__BFirm:BPHYT_RS25360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
40% identity, 95% coverage: 13:255/256 of query aligns to 16:258/259 of 5zaiC
- active site: A65 (= A62), F70 (≠ A67), S82 (≠ L79), R86 (≠ V83), G110 (= G107), E113 (= E110), P132 (≠ A129), E133 (≠ H130), I138 (≠ V135), P140 (= P137), G141 (= G138), A226 (≠ R223), F236 (≠ Q233)
- binding coenzyme a: K24 (≠ A21), L25 (≠ M22), A63 (= A60), G64 (= G61), A65 (= A62), D66 (= D63), I67 (≠ L64), P132 (≠ A129), R166 (≠ A163), F248 (= F245), K251 (= K248)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
35% identity, 99% coverage: 1:253/256 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (= A62), M70 (≠ A67), T80 (≠ I82), F84 (= F86), G108 (= G107), E111 (= E110), P130 (≠ A129), E131 (≠ H130), V136 (= V135), P138 (= P137), G139 (= G138), L224 (≠ R223), F234 (≠ Q233)
- binding acetoacetyl-coenzyme a: Q23 (≠ A20), A24 (= A21), L25 (≠ M22), A27 (≠ S24), A63 (= A60), G64 (= G61), A65 (= A62), D66 (= D63), I67 (≠ L64), K68 (≠ I65), M70 (≠ A67), F84 (= F86), G107 (≠ A106), G108 (= G107), E111 (= E110), P130 (≠ A129), E131 (≠ H130), P138 (= P137), G139 (= G138), M140 (≠ A139)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
35% identity, 99% coverage: 1:253/256 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (= A62), M70 (≠ A67), T80 (≠ I82), F84 (= F86), G108 (= G107), E111 (= E110), P130 (≠ A129), E131 (≠ H130), V136 (= V135), P138 (= P137), G139 (= G138), L224 (≠ R223), F234 (≠ Q233)
- binding coenzyme a: L25 (≠ M22), A63 (= A60), I67 (≠ L64), K68 (≠ I65), Y104 (≠ L103), P130 (≠ A129), E131 (≠ H130), L134 (≠ F133)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
35% identity, 96% coverage: 10:254/256 of query aligns to 15:252/254 of 2dubA
- active site: A67 (= A62), M72 (≠ A67), S82 (≠ E84), G105 (= G107), E108 (= E110), P127 (≠ A129), E128 (≠ H130), T133 (≠ V135), P135 (= P137), G136 (= G138), K221 (≠ R223), F231 (≠ Q233)
- binding octanoyl-coenzyme a: K25 (≠ A20), A26 (= A21), L27 (≠ M22), A29 (≠ S24), A65 (= A60), A67 (= A62), D68 (= D63), I69 (≠ L64), K70 (≠ I65), G105 (= G107), E108 (= E110), P127 (≠ A129), E128 (≠ H130), G136 (= G138), A137 (= A139)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
35% identity, 96% coverage: 10:254/256 of query aligns to 16:256/258 of 1mj3A
- active site: A68 (= A62), M73 (≠ A67), S83 (vs. gap), L85 (≠ V83), G109 (= G107), E112 (= E110), P131 (≠ A129), E132 (≠ H130), T137 (≠ V135), P139 (= P137), G140 (= G138), K225 (≠ R223), F235 (≠ Q233)
- binding hexanoyl-coenzyme a: K26 (≠ A20), A27 (= A21), L28 (≠ M22), A30 (≠ S24), A66 (= A60), G67 (= G61), A68 (= A62), D69 (= D63), I70 (≠ L64), G109 (= G107), P131 (≠ A129), E132 (≠ H130), L135 (≠ F133), G140 (= G138)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
35% identity, 96% coverage: 10:254/256 of query aligns to 16:258/260 of 1dubA
- active site: A68 (= A62), M73 (≠ A67), S83 (vs. gap), L87 (≠ V83), G111 (= G107), E114 (= E110), P133 (≠ A129), E134 (≠ H130), T139 (≠ V135), P141 (= P137), G142 (= G138), K227 (≠ R223), F237 (≠ Q233)
- binding acetoacetyl-coenzyme a: K26 (≠ A20), A27 (= A21), L28 (≠ M22), A30 (≠ S24), A66 (= A60), A68 (= A62), D69 (= D63), I70 (≠ L64), Y107 (≠ L103), G110 (≠ A106), G111 (= G107), E114 (= E110), P133 (≠ A129), E134 (≠ H130), L137 (≠ F133), G142 (= G138), F233 (≠ L229), F249 (= F245)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
35% identity, 95% coverage: 11:253/256 of query aligns to 13:253/256 of 3h81A
- active site: A64 (= A62), M69 (≠ A67), T79 (≠ I82), F83 (= F86), G107 (= G107), E110 (= E110), P129 (≠ A129), E130 (≠ H130), V135 (= V135), P137 (= P137), G138 (= G138), L223 (≠ R223), F233 (≠ Q233)
- binding calcium ion: F233 (≠ Q233), Q238 (≠ V238)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
35% identity, 96% coverage: 9:254/256 of query aligns to 45:288/290 of P14604
- E144 (= E110) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ H130) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
35% identity, 96% coverage: 10:254/256 of query aligns to 14:256/258 of 1ey3A
- active site: A66 (= A62), M71 (≠ A67), S81 (vs. gap), L85 (≠ V83), G109 (= G107), E112 (= E110), P131 (≠ A129), E132 (≠ H130), T137 (≠ V135), P139 (= P137), G140 (= G138), K225 (≠ R223), F235 (≠ Q233)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ A20), L26 (≠ M22), A28 (≠ S24), A64 (= A60), G65 (= G61), A66 (= A62), D67 (= D63), I68 (≠ L64), L85 (≠ V83), W88 (≠ F86), G109 (= G107), P131 (≠ A129), L135 (≠ F133), G140 (= G138)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
34% identity, 96% coverage: 9:254/256 of query aligns to 15:258/260 of 2hw5C
- active site: A68 (= A62), M73 (≠ A67), S83 (≠ L79), L87 (≠ V83), G111 (= G107), E114 (= E110), P133 (≠ A129), E134 (≠ H130), T139 (≠ V135), P141 (= P137), G142 (= G138), K227 (≠ R223), F237 (≠ Q233)
- binding crotonyl coenzyme a: K26 (≠ A20), A27 (= A21), L28 (≠ M22), A30 (≠ S24), K62 (≠ R56), I70 (≠ L64), F109 (≠ L105)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
35% identity, 95% coverage: 11:253/256 of query aligns to 13:249/250 of 3q0gD
- active site: A64 (= A62), M69 (≠ A67), T75 (≠ I82), F79 (= F86), G103 (= G107), E106 (= E110), P125 (≠ A129), E126 (≠ H130), V131 (= V135), P133 (= P137), G134 (= G138), L219 (≠ R223), F229 (≠ Q233)
- binding Butyryl Coenzyme A: F225 (≠ L229), F241 (= F245)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
37% identity, 95% coverage: 13:255/256 of query aligns to 18:260/261 of 5jbxB
- active site: A67 (= A62), R72 (≠ A67), L84 (= L79), R88 (≠ V83), G112 (= G107), E115 (= E110), T134 (≠ A129), E135 (≠ H130), I140 (≠ V135), P142 (= P137), G143 (= G138), A228 (≠ R223), L238 (≠ Q233)
- binding coenzyme a: S24 (≠ A20), R25 (≠ A21), R26 (≠ M22), A28 (≠ S24), A65 (= A60), D68 (= D63), L69 (= L64), K70 (≠ I65), L110 (= L105), G111 (≠ A106), T134 (≠ A129), E135 (≠ H130), L138 (≠ F133), R168 (≠ A163)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 94% coverage: 14:254/256 of query aligns to 21:264/266 of O53561
- K135 (≠ R125) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 125:132, 13% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ N132) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 96% coverage: 9:255/256 of query aligns to 11:256/257 of 6slbAAA
- active site: Q64 (≠ A62), F69 (≠ A67), L80 (= L79), N84 (≠ V83), A108 (≠ G107), S111 (≠ E110), A130 (= A129), F131 (≠ H130), L136 (≠ V135), P138 (= P137), D139 (≠ G138), A224 (≠ R223), G234 (≠ Q233)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (= R56), A62 (= A60), Q64 (≠ A62), D65 (= D63), L66 (= L64), Y76 (≠ R75), A108 (≠ G107), F131 (≠ H130), D139 (≠ G138)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 96% coverage: 9:255/256 of query aligns to 8:244/245 of 6slaAAA
- active site: Q61 (≠ A62), L68 (= L79), N72 (≠ V83), A96 (≠ G107), S99 (≠ E110), A118 (= A129), F119 (≠ H130), L124 (≠ V135), P126 (= P137), N127 (≠ G138), A212 (≠ R223), G222 (≠ Q233)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ M22), A59 (= A60), Q61 (≠ A62), D62 (= D63), L63 (= L64), L68 (= L79), Y71 (≠ I82), A94 (≠ L105), G95 (≠ A106), A96 (≠ G107), F119 (≠ H130), I122 (≠ F133), L124 (≠ V135), N127 (≠ G138), F234 (= F245), K237 (= K248)
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
33% identity, 88% coverage: 14:237/256 of query aligns to 14:222/224 of 3p85A
- active site: L62 (≠ A62), L67 (≠ I82), P68 (≠ V83), G92 (= G107), E95 (= E110), T114 (≠ A129), H115 (= H130), L120 (≠ V135), P122 (= P137), T123 (≠ G138), W208 (≠ R223), T219 (≠ R234)
- binding calcium ion: D43 (= D43), D45 (≠ A45)
3omeC Crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis (see paper)
34% identity, 84% coverage: 1:215/256 of query aligns to 3:216/247 of 3omeC
- active site: H65 (≠ A62), E70 (vs. gap), A82 (≠ R75), L86 (= L79), G110 (= G107), L113 (≠ E110), V133 (≠ H130), I138 (≠ V135), G139 (= G140), E142 (≠ A143)
- binding zinc ion: E81 (≠ G74), E142 (≠ A143)
Sites not aligning to the query:
7xwvA Feruloyl-coa hydratase/lyase complexed with vanillin and coenzyme a (see paper)
29% identity, 94% coverage: 5:245/256 of query aligns to 9:243/244 of 7xwvA
- binding coenzyme a: T24 (≠ A20), K25 (≠ A21), R26 (≠ M22), A64 (= A60), G65 (= G61), M66 (≠ A62), D67 (= D63), L68 (= L64), W111 (≠ L103), F113 (≠ L105), G114 (≠ A106), G115 (= G107), S137 (≠ A129)
- binding 4-hydroxy-3-methoxybenzaldehyde: M66 (≠ A62), Y71 (≠ A67), F72 (≠ A68), E138 (≠ H130), G146 (= G138), G147 (≠ A139)
7xwtB Crystal structure of feruoyl-coa hydratase/lyase complexed with coa from sphingomonas paucimobilis (see paper)
29% identity, 94% coverage: 5:245/256 of query aligns to 10:244/277 of 7xwtB
- binding acetyl coenzyme *a: T25 (≠ A20), K26 (≠ A21), R27 (≠ M22), A29 (≠ S24), A65 (= A60), G66 (= G61), M67 (≠ A62), D68 (= D63), L69 (= L64), F73 (≠ A68), F114 (≠ L105), G116 (= G107), S138 (≠ A129), W142 (≠ F133)
Q13825 Methylglutaconyl-CoA hydratase, mitochondrial; 3-MG-CoA hydratase; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding protein/enoyl-CoA hydratase; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 from Homo sapiens (Human) (see 4 papers)
33% identity, 95% coverage: 14:255/256 of query aligns to 92:338/339 of Q13825
- K105 (≠ R27) mutation to N: Abolishes RNA-binding; when associated with E-109 and Q-113.
- 105:119 (vs. 27:41, 13% identical) RNA-binding
- K109 (≠ T31) mutation to E: Abolishes RNA-binding; when associated with N-105 and Q-113.
- K113 (≠ A35) mutation to Q: Abolishes RNA-binding; when associated with N-105 and E-109.
- A240 (≠ G161) to V: in MGCA1; decreased methylglutaconyl-CoA hydratase activity; dbSNP:rs769894315
Sites not aligning to the query:
- 1:67 modified: transit peptide, Mitochondrion
Query Sequence
>BPHYT_RS25360 FitnessBrowser__BFirm:BPHYT_RS25360
MSYSHAVVDSVGWLTLDRPAAMNSLNREMATGLIAQLKAWRNDDAVRVLVVTGNGRAFCA
GADLIEAAEATQPGRREFLELIVEFFDTLRAFPKPVIAAVNGLALAGGLEVVLACDVVLA
AESARLGDAHSNFGVFPGAGGAAILPRKVPANVARYLLFTGDAMSAAELKGYGLVNEVLA
DAELRPRAQALAHKFAKKSPLVLARMKRVANETADKSAADALRHELLELRNHQRSYDVQE
GLRAFAEKREPQFKGC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory