SitesBLAST
Comparing BPHYT_RS25385 FitnessBrowser__BFirm:BPHYT_RS25385 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
27% identity, 96% coverage: 5:373/384 of query aligns to 5:378/380 of 2pg0A
- active site: M124 (≠ Y125), T125 (≠ S126), E243 (≠ A236), A364 (≠ F359), R376 (≠ A371)
- binding flavin-adenine dinucleotide: I122 (≠ L123), M124 (≠ Y125), T125 (≠ S126), G130 (≠ R131), S131 (≠ G132), F155 (≠ L156), I156 (≠ V157), T157 (≠ L158), R269 (= R262), F272 (= F265), F279 (= F272), Q337 (= Q332), L338 (= L333), G340 (= G335), G341 (= G336), V359 (= V354), I362 (≠ A357), Y363 (≠ L358), T366 (≠ S361), E368 (≠ D363), M369 (≠ Q364)
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
33% identity, 91% coverage: 1:349/384 of query aligns to 1:334/364 of 6wy8C
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
27% identity, 94% coverage: 1:362/384 of query aligns to 1:366/380 of 4l1fA
- active site: L125 (≠ Y125), T126 (≠ S126), G242 (≠ A236), E363 (≠ F359)
- binding coenzyme a persulfide: T132 (≠ G132), H179 (≠ E176), F232 (≠ L226), M236 (≠ R230), E237 (≠ H231), L239 (= L233), D240 (≠ S234), R243 (≠ T237), Y362 (≠ L358), E363 (≠ F359), G364 (= G360)
- binding flavin-adenine dinucleotide: F123 (≠ L123), L125 (≠ Y125), T126 (≠ S126), G131 (≠ R131), T132 (≠ G132), F156 (≠ L156), I157 (≠ V157), T158 (≠ L158), R268 (= R262), Q270 (= Q264), F271 (= F265), I275 (= I269), F278 (= F272), L281 (= L275), Q336 (= Q332), I337 (≠ L333), G340 (= G336), I358 (≠ V354), Y362 (≠ L358), T365 (≠ S361)
- binding 1,3-propandiol: L5 (= L5), Q10 (= Q10)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
32% identity, 90% coverage: 4:349/384 of query aligns to 1:331/361 of 6wy9B
Sites not aligning to the query:
3mpiC Structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex (see paper)
28% identity, 95% coverage: 1:363/384 of query aligns to 1:371/395 of 3mpiC
- active site: I128 (≠ Y125), T129 (≠ S126), T245 (≠ A236), E367 (≠ F359)
- binding flavin-adenine dinucleotide: I128 (≠ Y125), T129 (≠ S126), G134 (≠ R131), S135 (≠ G132), W159 (≠ L156), I160 (≠ V157), S161 (≠ L158), M365 (≠ A357), V366 (≠ L358), S369 (= S361), N371 (≠ D363)
- binding glutaryl-coenzyme A: R87 (vs. gap), F126 (≠ L123), S135 (≠ G132), V137 (≠ P134), S181 (≠ A175), F239 (≠ R230), R246 (≠ T237), N315 (≠ R310), V366 (≠ L358), E367 (≠ F359), G368 (= G360)
Sites not aligning to the query:
4x28D Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
30% identity, 91% coverage: 1:349/384 of query aligns to 1:335/364 of 4x28D
Sites not aligning to the query:
C3UVB0 Glutaryl-CoA dehydrogenase; GDH(Des); EC 1.3.99.32 from Desulfococcus multivorans (see paper)
28% identity, 95% coverage: 1:363/384 of query aligns to 1:371/389 of C3UVB0
- A80 (≠ G79) mutation to E: Loses the FAD cofactor and dehydrogenase activity.
- R87 (vs. gap) binding
- V88 (vs. gap) mutation to S: A residual dehydrogenase activity is observed.
- N91 (≠ V83) binding
- FGIT 126:129 (≠ LAYS 123:126) binding
- S135 (≠ G132) binding ; binding
- WIS 159:161 (≠ LVL 156:158) binding
- S181 (≠ A175) binding
- R271 (= R262) binding
- FQMN 281:284 (≠ FQAL 272:275) binding
- R340 (≠ Q332) binding
- A344 (≠ G336) binding
- V366 (≠ L358) mutation to Y: Loses the FAD cofactor but a residual dehydrogenase activity is observed.
- EGSAN 367:371 (≠ FGSSD 359:363) binding
Sites not aligning to the query:
3mpjB Structure of the glutaryl-coenzyme a dehydrogenase (see paper)
28% identity, 95% coverage: 1:363/384 of query aligns to 1:371/393 of 3mpjB
- active site: I128 (≠ Y125), T129 (≠ S126), T245 (≠ A236), E367 (≠ F359)
- binding flavin-adenine dinucleotide: F126 (≠ L123), I128 (≠ Y125), T129 (≠ S126), G134 (≠ R131), S135 (≠ G132), W159 (≠ L156), I160 (≠ V157), S161 (≠ L158), V366 (≠ L358), S369 (= S361), N371 (≠ D363)
- binding : H36 (≠ R29), F37 (≠ M30), Y39 (≠ F32), A164 (= A161), Q165 (≠ D162), D167 (= D164), N193 (≠ D186)
Sites not aligning to the query:
I6Y3Q0 Acyl-CoA dehydrogenase FadE27; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 91% coverage: 1:349/384 of query aligns to 1:344/373 of I6Y3Q0
- R251 (= R262) binding
- H327 (≠ Q332) binding
- G331 (= G336) binding
2z1qB Crystal structure of acyl coa dehydrogenase
30% identity, 82% coverage: 51:363/384 of query aligns to 69:398/549 of 2z1qB
- active site: L144 (≠ Y125), T145 (≠ S126), G259 (≠ A236), E394 (≠ F359)
- binding flavin-adenine dinucleotide: Y142 (≠ L123), L144 (≠ Y125), T145 (≠ S126), G150 (≠ R131), S151 (≠ G132), W177 (≠ L156), S179 (≠ L158), R285 (= R262), F288 (= F265), I292 (= I269), F295 (= F272), I298 (≠ L275), H369 (= H334), G370 (= G335), F393 (≠ L358)
Sites not aligning to the query:
4ktoA Crystal structure of a putative isovaleryl-coa dehydrogenase (psi- nysgrc-012251) from sinorhizobium meliloti 1021
30% identity, 95% coverage: 1:363/384 of query aligns to 6:364/377 of 4ktoA
- active site: M130 (≠ Y125), S131 (= S126), E239 (≠ A236), A360 (≠ F359)
- binding flavin-adenine dinucleotide: L128 (= L123), M130 (≠ Y125), S131 (= S126), M155 (≠ T155), W156 (≠ L156), T158 (≠ L158), R265 (= R262), F268 (= F265), I272 (= I269), F275 (= F272), M278 (≠ L275), Q333 (= Q332), A334 (≠ L333), G337 (= G336), L355 (≠ V354), G359 (≠ L358), T362 (≠ S361), E364 (≠ D363)
Sites not aligning to the query:
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
29% identity, 71% coverage: 93:363/384 of query aligns to 96:371/383 of 1bucA
- active site: L128 (≠ Y125), T129 (≠ S126), G246 (≠ A236), E367 (≠ F359)
- binding acetoacetyl-coenzyme a: L96 (= L93), F126 (≠ L123), G134 (≠ R131), T135 (≠ G132), T162 (≠ L158), N182 (≠ A175), H183 (≠ E176), F236 (≠ L226), M240 (≠ R230), M241 (≠ H231), L243 (= L233), D244 (≠ S234), T317 (≠ A307), Y366 (≠ L358), E367 (≠ F359), G368 (= G360)
- binding flavin-adenine dinucleotide: F126 (≠ L123), L128 (≠ Y125), T129 (≠ S126), G134 (≠ R131), T135 (≠ G132), F160 (≠ L156), T162 (≠ L158), Y366 (≠ L358), T369 (≠ S361), E371 (≠ D363)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
29% identity, 71% coverage: 93:363/384 of query aligns to 96:371/383 of Q06319
- E367 (≠ F359) active site, Proton acceptor; mutation to Q: Loss of activity.
6cxtB Crystal structure of fad-dependent dehydrogenase (see paper)
27% identity, 96% coverage: 1:369/384 of query aligns to 1:366/372 of 6cxtB
- active site: I117 (≠ Y125), S118 (= S126), E234 (≠ A236)
- binding flavin-adenine dinucleotide: N115 (≠ L123), I117 (≠ Y125), S118 (= S126), G123 (≠ R131), S124 (≠ G132), Y148 (≠ L156), T150 (≠ L158), L201 (= L197), F354 (≠ L358), T357 (≠ S361), D359 (= D363), I360 (vs. gap)
- binding S-[2-({N-[(2R)-2-hydroxy-4-{[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]oxy}-3,3-dimethylbutanoyl]-beta-alanyl}amino)ethyl] 1H-pyrrole-2-carbothioate: A81 (= A91), N115 (≠ L123), S124 (≠ G132), F227 (≠ L229), M231 (≠ L233), E234 (≠ A236), R235 (≠ T237), F354 (≠ L358), S355 (≠ F359), G356 (= G360), I360 (vs. gap)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
30% identity, 84% coverage: 51:373/384 of query aligns to 50:378/378 of 4n5fA
- active site: L126 (≠ Y125), T127 (≠ S126), G243 (≠ A236), E364 (≠ F359), R376 (≠ A371)
- binding dihydroflavine-adenine dinucleotide: L126 (≠ Y125), T127 (≠ S126), G132 (≠ R131), S133 (≠ G132), F157 (≠ L156), T159 (≠ L158), T210 (vs. gap), Y363 (≠ L358), T366 (≠ S361), E368 (≠ D363), M372 (≠ A367)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 90% coverage: 1:345/384 of query aligns to 1:348/379 of 1ukwB
- active site: L124 (≠ Y125), S125 (= S126), T241 (≠ A236)
- binding cobalt (ii) ion: D145 (= D146), H146 (≠ G147)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ Y125), S125 (= S126), G130 (≠ R131), S131 (≠ G132), W155 (≠ L156), S157 (≠ L158), K200 (vs. gap)
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 90% coverage: 1:345/384 of query aligns to 1:348/379 of 1ukwA
Sites not aligning to the query:
4irnA Crystal structure of the prolyl acyl carrier protein oxidase anab (see paper)
28% identity, 93% coverage: 7:363/384 of query aligns to 17:366/378 of 4irnA
- active site: A124 (≠ Y125), T125 (≠ S126), E241 (≠ A236), S362 (≠ F359)
- binding flavin-adenine dinucleotide: H122 (≠ L123), A124 (≠ Y125), T125 (≠ S126), G130 (≠ R131), S131 (≠ G132), Y155 (≠ L156), T157 (≠ L158), H267 (≠ R262), Q269 (= Q264), F270 (= F265), I274 (= I269), F277 (= F272), V280 (≠ L275), E335 (≠ Q332), I336 (≠ L333), G338 (= G335), A339 (≠ G336), F360 (≠ A357), E366 (≠ D363)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
24% identity, 86% coverage: 45:373/384 of query aligns to 42:376/378 of 5ol2F
- active site: L124 (≠ Y125), T125 (≠ S126), G241 (≠ A236), G374 (≠ A371)
- binding coenzyme a persulfide: L238 (= L233), R242 (≠ T237), E362 (≠ F359), G363 (= G360)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ Y125), T125 (≠ S126), P127 (≠ A128), T131 (≠ G132), F155 (≠ L156), I156 (≠ V157), T157 (≠ L158), E198 (≠ R192), R267 (= R262), F270 (= F265), L274 (≠ I269), F277 (= F272), Q335 (= Q332), L336 (= L333), G338 (= G335), G339 (= G336), Y361 (≠ L358), T364 (≠ S361), E366 (≠ D363)
Sites not aligning to the query:
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
25% identity, 93% coverage: 5:362/384 of query aligns to 3:365/379 of 6fahD
- active site: L124 (≠ Y125), T125 (≠ S126), G241 (≠ A236)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ Y125), T125 (≠ S126), R152 (≠ S153), F155 (≠ L156), T157 (≠ L158), E198 (≠ R192), R267 (= R262), Q269 (= Q264), F270 (= F265), I274 (= I269), F277 (= F272), Q335 (= Q332), I336 (≠ L333), G339 (= G336), Y361 (≠ L358), T364 (≠ S361)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS25385 FitnessBrowser__BFirm:BPHYT_RS25385
MNFTLSAEQQLLQDSVRRFVDRDYSFETRMAFVKARSTCSATHWQTFADNGWLAAALPES
CGGFDGSLTDTVLIASELGRGLVIEPYLGCAVLAAQTLLAGATPAQREQWLPALADGSRK
FALAYSEAQSRGFPEFVETSATPTPDGYSLAGSKTLVLGGADADSFIVSARAQDAEGITL
MLVPGDAPGLARRVLPLHDGSFAAELTLDGVRVTREAVLGVPGPGLTALRHALSHATAAL
GAELVGAMEKSIELTAEYLRVRKQFGVPIGSFQALQHRLADMAAEMELARSMLHALLGSL
ENDAPPARLRAVSQAKSVIGRAARFVCGQAIQLHGGIGMTEEYQVGHYYKRAVVADALFG
SSDQHDAACAAQLQNELLQKENHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory