Comparing BPHYT_RS25610 FitnessBrowser__BFirm:BPHYT_RS25610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
Q53464 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; L-DEX; EC 3.8.1.2 from Pseudomonas sp. (strain YL) (see 2 papers)
58% identity, 99% coverage: 1:226/228 of query aligns to 1:226/232 of Q53464
1zrmA Crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate (see paper)
59% identity, 96% coverage: 4:221/228 of query aligns to 2:219/220 of 1zrmA
3umbA Crystal structure of the l-2-haloacid dehalogenase rsc1362
44% identity, 96% coverage: 4:222/228 of query aligns to 3:225/227 of 3umbA
Q60099 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; EC 3.8.1.2 from Xanthobacter autotrophicus (see 2 papers)
43% identity, 96% coverage: 4:222/228 of query aligns to 2:241/253 of Q60099
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
38% identity, 98% coverage: 4:226/228 of query aligns to 5:227/231 of Q51645
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
40% identity, 86% coverage: 4:199/228 of query aligns to 5:200/226 of 2no5B
2yn4A L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium (see paper)
30% identity, 94% coverage: 7:220/228 of query aligns to 4:217/225 of 2yn4A
8wbqB Crystal structure of cis-epoxysuccinate hydrolases rhcesh[l] mutant e212q complexed with l-ta. (see paper)
30% identity, 96% coverage: 4:223/228 of query aligns to 10:240/244 of 8wbqB
8wbtA Crystal structure of cis-epoxysuccinate hydrolases klcesh[l] mutant d48n complexed with l-ta (see paper)
30% identity, 85% coverage: 4:196/228 of query aligns to 3:201/237 of 8wbtA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
30% identity, 61% coverage: 84:223/228 of query aligns to 74:211/215 of 4ygrA
Sites not aligning to the query:
6z1kA A de novo enzyme for the morita-baylis-hillman reaction bh32.6 (see paper)
28% identity, 55% coverage: 97:222/228 of query aligns to 102:226/231 of 6z1kA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
28% identity, 55% coverage: 97:222/228 of query aligns to 102:226/230 of 6q7nA
Sites not aligning to the query:
4ffdA Crystal structure of engineered protein. Northeast structural genomics consortium target or48
28% identity, 55% coverage: 97:222/228 of query aligns to 102:226/230 of 4ffdA
Sites not aligning to the query:
>BPHYT_RS25610 FitnessBrowser__BFirm:BPHYT_RS25610
MKPIKALVFDLYGTLYDVHSVAGACGERFPGRGLEISILWRQKQLEYTWLRTLMGDYVPF
EKATDDALDFVASHLKLSLTTAAHKDLCDAYLRLQPYPGVEATLTSLRERGLPLAILSNG
SSFSIGSVVKNSGLDHLFDHLISVESTKVFKPHDAVYRLAENALGWSRDEILFVSSNGWD
ACGARHFGYQVCWVNRNGNTLDVLGQKPDFAVTDLRELPDLVGNAVMS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory