Comparing BPHYT_RS25790 FitnessBrowser__BFirm:BPHYT_RS25790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 96% coverage: 1:481/500 of query aligns to 5:477/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 47% coverage: 1:235/500 of query aligns to 3:228/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 47% coverage: 1:235/500 of query aligns to 1:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 47% coverage: 1:235/500 of query aligns to 1:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 47% coverage: 1:235/500 of query aligns to 1:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 47% coverage: 1:235/500 of query aligns to 1:230/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 49% coverage: 6:252/500 of query aligns to 7:234/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 44% coverage: 1:221/500 of query aligns to 18:225/378 of P69874
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 43% coverage: 6:221/500 of query aligns to 10:216/230 of 6z4wA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 44% coverage: 1:221/500 of query aligns to 7:220/375 of 2d62A
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 43% coverage: 6:221/500 of query aligns to 10:216/229 of 6z67B
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 44% coverage: 8:226/500 of query aligns to 12:232/254 of 1g6hA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 45% coverage: 7:230/500 of query aligns to 12:227/343 of P30750
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 44% coverage: 8:226/500 of query aligns to 12:232/253 of 1g9xB
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 45% coverage: 7:230/500 of query aligns to 13:228/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 45% coverage: 7:230/500 of query aligns to 13:228/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 45% coverage: 7:230/500 of query aligns to 13:228/344 of 6cvlD
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 49% coverage: 19:264/500 of query aligns to 23:263/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 49% coverage: 19:264/500 of query aligns to 23:263/263 of 7d08B
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 47% coverage: 9:242/500 of query aligns to 20:246/265 of P07821
>BPHYT_RS25790 FitnessBrowser__BFirm:BPHYT_RS25790
MQVVGVHKRFTGVHALRGVSLSFERGQIYHLLGENGCGKSTLIKIISGAQPPDEGELVIE
GVRHARLSALESLAAGIETVYQDLSLLPNMNVAENVALTSELATHQGKLARTFDRRELAR
TAARALEAVGLPGNAEFQATLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKEV
DNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAQFTKAQISELM
TGRHLSNERYREGAHEPNIVLEVRGYTRAGQFSDVSFGLHGGEILGITGLLDSGRNELAR
ALAGVAPAQSGQVRLDGKSISLRTPSDAKNHRIGYVPEDRLNEGLFLDKPIRDNVITAMI
SSLRDRFGQIDRVRAQALAEQTVKDLQIATPGVDKPVQSLSGGNQQRVLIGRWLAIDPRV
LILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGRVASE
YQADTLSEADLYHALLSEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory