SitesBLAST
Comparing BPHYT_RS25805 FitnessBrowser__BFirm:BPHYT_RS25805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 94% coverage: 7:314/328 of query aligns to 1:307/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
39% identity, 93% coverage: 11:314/328 of query aligns to 4:306/307 of 1gqtB
- active site: A251 (≠ G259), A252 (= A260), G253 (= G261), D254 (= D262)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N193), T222 (= T229), G224 (= G231), S225 (≠ E232), A252 (= A260), G253 (= G261), H278 (≠ C286), A281 (= A289)
- binding cesium ion: D248 (≠ E256), I250 (≠ A258), A284 (≠ S292), R287 (= R295), S293 (= S301)
- binding alpha-D-ribofuranose: N13 (≠ V20), D15 (= D22), G41 (= G48), N45 (= N52), E142 (= E149), D254 (= D262)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
39% identity, 93% coverage: 12:316/328 of query aligns to 3:306/306 of 4xckA
- active site: A249 (≠ G259), A250 (= A260), G251 (= G261), D252 (= D262)
- binding adenosine-5'-diphosphate: T220 (= T229), G222 (= G231), S223 (≠ E232), V242 (≠ C251), T247 (= T257), A250 (= A260), F254 (= F264), H276 (≠ C286), A279 (= A289), V283 (= V293)
- binding alpha-D-ribofuranose: N11 (≠ V20), D13 (= D22), G39 (= G48), K40 (= K49), N43 (= N52), A95 (= A103), I107 (= I116), I109 (≠ V118), E140 (= E149), T248 (≠ A258), D252 (= D262)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
39% identity, 93% coverage: 11:314/328 of query aligns to 2:304/305 of 1rk2A
- active site: A249 (≠ G259), A250 (= A260), G251 (= G261), D252 (= D262)
- binding adenosine-5'-diphosphate: T220 (= T229), G222 (= G231), S223 (≠ E232), A250 (= A260), G251 (= G261), H276 (≠ C286), A279 (= A289)
- binding tetrafluoroaluminate ion: G213 (= G222), R215 (≠ G224)
- binding magnesium ion: D246 (≠ E256), A282 (≠ S292), R285 (= R295), S291 (= S301)
- binding alpha-D-ribofuranose: N11 (≠ V20), D13 (= D22), G38 (= G47), G39 (= G48), K40 (= K49), N43 (= N52), E140 (= E149), D252 (= D262)
2fv7A Crystal structure of human ribokinase
38% identity, 89% coverage: 13:303/328 of query aligns to 4:298/308 of 2fv7A
- active site: G252 (= G259), A253 (= A260), G254 (= G261), D255 (= D262)
- binding adenosine-5'-diphosphate: N185 (= N193), T221 (= T229), G223 (= G231), G226 (= G234), T242 (≠ A248), V245 (≠ C251), A253 (= A260), G254 (= G261), N281 (≠ R283), A284 (= A289), A285 (≠ G290), V288 (= V293)
5c3yA Structure of human ribokinase crystallized with amppnp
38% identity, 89% coverage: 13:303/328 of query aligns to 4:298/306 of 5c3yA
- active site: G252 (= G259), A253 (= A260), G254 (= G261), D255 (= D262)
- binding amp phosphoramidate: T221 (= T229), G223 (= G231), V245 (≠ C251), T250 (= T257), G254 (= G261), N281 (≠ R283), A284 (= A289), A285 (≠ G290)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
38% identity, 89% coverage: 13:303/328 of query aligns to 5:299/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N193), T222 (= T229), G224 (= G231), A225 (≠ E232), G227 (= G234), T243 (≠ A248), V246 (≠ C251), A254 (= A260), G255 (= G261), N282 (≠ R283), A285 (= A289), A286 (≠ G290), V289 (= V293)
- binding alpha-D-ribofuranose: D14 (= D22), G40 (= G48), K41 (= K49), N44 (= N52), A96 (= A103), E141 (= E149), D256 (= D262)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
38% identity, 89% coverage: 13:303/328 of query aligns to 5:299/317 of 5c41A
- active site: G253 (= G259), A254 (= A260), G255 (= G261), D256 (= D262)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N193), T222 (= T229), G224 (= G231), A225 (≠ E232), G227 (= G234), V246 (≠ C251), G255 (= G261), N282 (≠ R283), A285 (= A289), A286 (≠ G290)
6wjzA Crystal structure of human ribokinase in complex with ampcp
38% identity, 89% coverage: 13:303/328 of query aligns to 5:299/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N193), T222 (= T229), G224 (= G231), A225 (≠ E232), G227 (= G234), T243 (≠ A248), V246 (≠ C251), A254 (= A260), G255 (= G261), N282 (≠ R283), A285 (= A289), A286 (≠ G290), V289 (= V293)
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
38% identity, 88% coverage: 17:303/328 of query aligns to 22:312/322 of Q9H477
5byfA Crystal structure of human ribokinase in complex with amp
38% identity, 88% coverage: 17:303/328 of query aligns to 10:300/313 of 5byfA
8cqxA Ribokinase from t.Sp mutant a92g
36% identity, 91% coverage: 13:312/328 of query aligns to 2:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N193), T217 (= T229), G219 (= G231), A220 (≠ E232), G222 (= G234), F250 (= F264), N272 (≠ C286), G275 (≠ A289), A276 (≠ G290), T279 (≠ V293)
- binding magnesium ion: D242 (≠ E256), T244 (≠ A258), A278 (≠ S292), S287 (= S301)
6a8cA Ribokinase from leishmania donovani with adp (see paper)
35% identity, 90% coverage: 13:308/328 of query aligns to 16:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G231), A246 (≠ E232), T271 (= T257), A274 (= A260), G275 (= G261), N300 (≠ C286), A303 (= A289)
- binding glycerol: D25 (= D22), S42 (≠ G39), S44 (≠ A41), G50 (= G47), G51 (= G48), N55 (= N52)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
35% identity, 90% coverage: 13:308/328 of query aligns to 16:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G231), A246 (≠ E232), T271 (= T257), A274 (= A260), G275 (= G261), N300 (≠ C286), A303 (= A289), V307 (= V293)
- binding glycerol: D25 (= D22), G50 (= G47), G51 (= G48), N55 (= N52), N157 (≠ L148), I159 (≠ Q150), E190 (≠ D180)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
35% identity, 90% coverage: 13:308/328 of query aligns to 16:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N193), T243 (= T229), G245 (= G231), A246 (≠ E232), G248 (= G234), T271 (= T257), G273 (= G259), A274 (= A260), G275 (= G261), N300 (≠ C286), A303 (= A289), V307 (= V293)
- binding glycerol: D25 (= D22), G50 (= G47), G51 (= G48), N55 (= N52)
6znxC Ribokinase from thermus species
34% identity, 83% coverage: 42:312/328 of query aligns to 18:263/265 of 6znxC
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 92% coverage: 13:313/328 of query aligns to 71:376/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
29% identity, 92% coverage: 13:313/328 of query aligns to 5:310/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N193), K225 (≠ T229), G227 (= G231), I246 (≠ V246), A248 (= A248), A257 (= A260), G258 (= G261), F261 (= F264), A286 (= A289), S287 (≠ G290)
- binding alpha-D-ribofuranose: N12 (≠ V20), D14 (= D22), G40 (= G48), K41 (= K49), N44 (= N52), E144 (= E149), D259 (= D262)
3i3yD Crystal structure of ribokinase in complex with d-ribose from klebsiella pneumoniae
31% identity, 80% coverage: 12:275/328 of query aligns to 2:246/285 of 3i3yD
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
31% identity, 80% coverage: 12:275/328 of query aligns to 3:247/286 of 3ikhA
Sites not aligning to the query:
Query Sequence
>BPHYT_RS25805 FitnessBrowser__BFirm:BPHYT_RS25805
MNTPAQLNGKGRVVILGIYVTDLTFRAGRMPQIGETIAGTAFAMGPGGKGSNQAVAAARV
GADVVFCTRIGNDAFGSIARATWAAEGITARASVIDGVSTGAAHIFVDDNTGMNAIIVAS
GAAGTMEAADVDAIEADIAAARVFVTQLEQPLAAARRGLEVARKHGVITVFNPAPAMPLD
DAIFPLCDYITPNETEATALTGVPIANADDARRAADVLLAKGVGTAIITLGEGGALLHSA
NQSLLVPAYHCGRVVETAGAGDGFTGGFAAALARGDDAITALRFGCALAGISVTRPGTAP
SMPTLDEVNQVLNQPSQPNQAAGVSQPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory