SitesBLAST
Comparing BPHYT_RS25960 FitnessBrowser__BFirm:BPHYT_RS25960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 77% coverage: 2:236/304 of query aligns to 7:222/378 of P69874
- C26 (≠ R20) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F21) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F62) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C71) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ I77) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L93) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V149) mutation to M: Loss of ATPase activity and transport.
- D172 (= D186) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 70% coverage: 32:245/304 of query aligns to 6:224/375 of 2d62A
1g291 Malk (see paper)
39% identity, 66% coverage: 45:245/304 of query aligns to 14:221/372 of 1g291
- binding magnesium ion: D69 (≠ G100), E71 (≠ G102), K72 (≠ A103), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S69), G39 (= G70), C40 (= C71), G41 (= G72), K42 (= K73), T43 (≠ S74), T44 (= T75)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
42% identity, 64% coverage: 43:237/304 of query aligns to 11:208/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Q44), S37 (= S69), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), Q81 (= Q110), R128 (≠ A157), A132 (≠ Q161), S134 (= S163), G136 (= G165), Q137 (≠ M166), E158 (= E187), H191 (= H220)
- binding magnesium ion: S42 (= S74), Q81 (= Q110)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
42% identity, 64% coverage: 43:237/304 of query aligns to 11:208/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Q44), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), R128 (≠ A157), S134 (= S163), Q137 (≠ M166)
- binding beryllium trifluoride ion: S37 (= S69), G38 (= G70), K41 (= K73), Q81 (= Q110), S134 (= S163), G136 (= G165), H191 (= H220)
- binding magnesium ion: S42 (= S74), Q81 (= Q110)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
42% identity, 64% coverage: 43:237/304 of query aligns to 11:208/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Q44), V17 (≠ A49), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), R128 (≠ A157), A132 (≠ Q161), S134 (= S163), Q137 (≠ M166)
- binding tetrafluoroaluminate ion: S37 (= S69), G38 (= G70), K41 (= K73), Q81 (= Q110), S134 (= S163), G135 (= G164), G136 (= G165), E158 (= E187), H191 (= H220)
- binding magnesium ion: S42 (= S74), Q81 (= Q110)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
42% identity, 64% coverage: 43:237/304 of query aligns to 11:208/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Q44), V17 (≠ A49), G38 (= G70), C39 (= C71), G40 (= G72), K41 (= K73), S42 (= S74), T43 (= T75), R128 (≠ A157), A132 (≠ Q161), S134 (= S163), Q137 (≠ M166)
- binding magnesium ion: S42 (= S74), Q81 (= Q110)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
42% identity, 64% coverage: 43:237/304 of query aligns to 12:209/371 of P68187
- A85 (≠ T113) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S134) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A142) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ W145) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D147) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T152) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G165) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D186) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
42% identity, 64% coverage: 43:237/304 of query aligns to 11:208/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
42% identity, 64% coverage: 43:237/304 of query aligns to 9:206/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Q44), S35 (= S69), G36 (= G70), C37 (= C71), G38 (= G72), K39 (= K73), S40 (= S74), T41 (= T75), R126 (≠ A157), A130 (≠ Q161), S132 (= S163), G134 (= G165), Q135 (≠ M166)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 66% coverage: 38:238/304 of query aligns to 7:210/369 of P19566
- L86 (= L114) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P188) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D193) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 70% coverage: 23:236/304 of query aligns to 15:237/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
37% identity, 70% coverage: 23:236/304 of query aligns to 15:237/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
39% identity, 63% coverage: 45:236/304 of query aligns to 37:237/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ C47), S61 (= S69), G62 (= G70), G64 (= G72), K65 (= K73), S66 (= S74), T67 (= T75), Q111 (= Q110), K161 (≠ H160), Q162 (= Q161), S164 (= S163), G166 (= G165), M167 (= M166), Q188 (≠ E187), H221 (= H220)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 61% coverage: 61:245/304 of query aligns to 30:215/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S69), G39 (= G70), G41 (= G72), K42 (= K73), S43 (= S74), Q82 (= Q110), Q133 (= Q161), G136 (= G164), G137 (= G165), Q138 (≠ M166), H192 (= H220)
- binding magnesium ion: S43 (= S74), Q82 (= Q110)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 61% coverage: 61:245/304 of query aligns to 30:215/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S69), C40 (= C71), G41 (= G72), K42 (= K73), S43 (= S74), T44 (= T75), Q82 (= Q110), R129 (≠ A157), Q133 (= Q161), S135 (= S163), G136 (= G164), G137 (= G165), Q159 (≠ E187), H192 (= H220)
- binding magnesium ion: S43 (= S74), Q82 (= Q110)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 61% coverage: 61:245/304 of query aligns to 28:213/384 of 8hplC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 66% coverage: 48:249/304 of query aligns to 18:226/393 of P9WQI3
- H193 (= H220) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 73% coverage: 30:250/304 of query aligns to 1:220/348 of 3d31A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 81% coverage: 30:276/304 of query aligns to 2:241/241 of 4u00A
Query Sequence
>BPHYT_RS25960 FitnessBrowser__BFirm:BPHYT_RS25960
MLNPQPVPSYLIQSEAVRERFDRLKSREVILEVKDLGKRFKAAQGECTALDGISFKTHRR
EFVCVIGPSGCGKSTLIRILAGLEAQTSGSVLLDGKPVQGPGADRGMVFQGYTLFPWLTV
KKNVMFGLKMNGHSTLHAEREALQWLDLVGLTKFANAYPHQLSGGMKQRVAIARALANRP
RILLMDEPFGALDAQTRAKMQTHLLDIWRNIDVTVLFITHDLDEAIFLADRILVLKANPG
EVQELIEVPVPRPRDYSQVTSPEFLATKARLEALIHPPTETRDDEDDVVKPHMIRMTDVA
DNVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory