Comparing BPHYT_RS26080 FitnessBrowser__BFirm:BPHYT_RS26080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
31% identity, 95% coverage: 9:507/527 of query aligns to 3:480/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 41% coverage: 10:224/527 of query aligns to 4:231/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 41% coverage: 10:224/527 of query aligns to 4:231/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 41% coverage: 10:226/527 of query aligns to 1:219/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 40% coverage: 10:222/527 of query aligns to 2:215/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 41% coverage: 10:226/527 of query aligns to 1:224/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 41% coverage: 10:226/527 of query aligns to 2:225/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 41% coverage: 10:226/527 of query aligns to 2:225/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 41% coverage: 10:226/527 of query aligns to 2:225/344 of 6cvlD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
29% identity, 42% coverage: 8:227/527 of query aligns to 1:222/223 of 2pclA
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 40% coverage: 18:229/527 of query aligns to 11:223/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 40% coverage: 18:229/527 of query aligns to 11:223/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 40% coverage: 18:229/527 of query aligns to 11:223/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 40% coverage: 18:229/527 of query aligns to 11:223/242 of 2oljA
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 40% coverage: 10:222/527 of query aligns to 1:207/348 of 3d31A
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
29% identity, 41% coverage: 10:223/527 of query aligns to 4:216/285 of 4yerA
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
30% identity, 41% coverage: 10:223/527 of query aligns to 1:217/222 of 8i6rB
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 40% coverage: 9:221/527 of query aligns to 5:221/375 of 2d62A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
29% identity, 41% coverage: 10:226/527 of query aligns to 5:228/233 of P75957
7mdyC Lolcde nucleotide-bound
29% identity, 41% coverage: 10:226/527 of query aligns to 2:225/226 of 7mdyC
>BPHYT_RS26080 FitnessBrowser__BFirm:BPHYT_RS26080
MSAGTPRAAVLRMDGIVKRFGAFQALTDVSLELFAGEVHCLLGENGAGKSTLCNVMFGVH
QPDAGAMWLDGAPYQPHSPRDALTHGIAMVHQHFSLVEDVSVLDNLLLGQVRGWLDRKRE
AQRVRALVAELGLALDPDTRVADLSVGEKQRVEIVKCLIREPRLLVLDEPTAVLLPAEID
ALLDTCARVVARGCAVVLVTHKLAEIRRIASRATVLQSGRVVARSSKPSADVDALVRAMI
QRPDSTDQGAAANSNASATPRSATRSTSPYTRPLADEALQIDGLTVRDADGVTRLEDCTL
VVNRGEIVGIAGVEGNGQSELGAVLAGMQKASAGRFFVQGKDCTQAAPQTLTRAGVGVVP
EDRHAVGCVPDMSLTENLFLNRLDDYARGGFMRRRAMRRDARALMQRFDVRAASPDVAFR
GLSGGNQQKAVLARELTLDGLAVLVAAQPTRGLDVGAVAAVYDHIRAARDAGVGVLLISS
ELDELMAVADRVLVMYRGRIMGTCVPEASQFNLQRERIGAWMAGQTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory