SitesBLAST
Comparing BPHYT_RS26530 FitnessBrowser__BFirm:BPHYT_RS26530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 47% coverage: 217:408/409 of query aligns to 174:367/370 of 4yshA
- active site: I262 (≠ A306), L283 (= L325), G305 (= G346), N335 (≠ L376), L338 (≠ T379)
- binding flavin-adenine dinucleotide: V178 (= V221), S206 (≠ T249), G207 (= G250), W209 (≠ R252), R307 (= R348), H332 (= H373), R334 (≠ H375), N335 (≠ L376), G336 (= G377), I337 (≠ L378)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 47% coverage: 217:408/409 of query aligns to 174:367/368 of 4yshB
- active site: I262 (≠ A306), L283 (= L325), G305 (= G346), N335 (≠ L376), L338 (≠ T379)
- binding flavin-adenine dinucleotide: V178 (= V221), S206 (≠ T249), W209 (≠ R252), R307 (= R348), H332 (= H373), R334 (≠ H375), N335 (≠ L376), G336 (= G377), I337 (≠ L378), L338 (≠ T379)
- binding glycine: G249 (= G293), Y251 (= Y295), Y251 (= Y295), A264 (≠ T308), R307 (= R348), R334 (≠ H375), R334 (≠ H375)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
27% identity, 47% coverage: 217:408/409 of query aligns to 176:369/377 of Q5L2C2
- V180 (= V221) binding
- R309 (= R348) binding
- 334:340 (vs. 373:379, 29% identical) binding
- R336 (≠ H375) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
28% identity, 39% coverage: 243:400/409 of query aligns to 196:354/364 of 3if9A
- binding flavin-adenine dinucleotide: S202 (≠ T249), G203 (= G250), W205 (≠ R252), F209 (= F256), G300 (= G346), R302 (= R348), H327 (= H373), F328 (≠ Q374), R329 (≠ H375), N330 (≠ L376), G331 (= G377), I332 (≠ L378)
- binding glycolic acid: Y246 (= Y295), R302 (= R348), R329 (≠ H375)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 173, 174
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
28% identity, 39% coverage: 243:400/409 of query aligns to 196:354/369 of O31616
- H244 (≠ P286) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R348) binding
- 327:333 (vs. 373:379, 29% identical) binding
- R329 (≠ H375) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
28% identity, 39% coverage: 243:400/409 of query aligns to 196:354/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y295), R302 (= R348), R329 (≠ H375)
- binding flavin-adenine dinucleotide: S202 (≠ T249), G203 (= G250), W205 (≠ R252), F209 (= F256), G300 (= G346), R302 (= R348), H327 (= H373), R329 (≠ H375), N330 (≠ L376), G331 (= G377), I332 (≠ L378)
- binding phosphate ion: R254 (vs. gap)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
25% identity, 58% coverage: 154:392/409 of query aligns to 104:344/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (≠ A211), G200 (≠ T249), G201 (= G250), W203 (≠ R252), G298 (= G346), R300 (= R348), P301 (= P349), Y326 (≠ Q374), R327 (≠ H375), N328 (≠ L376), G329 (= G377), I330 (≠ L378)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 43% coverage: 216:392/409 of query aligns to 169:346/369 of S5FMM4
- S202 (≠ T249) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L378) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V388) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 65% coverage: 143:409/409 of query aligns to 93:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ G288), Y252 (= Y295), Y267 (≠ V309), R308 (= R348), R334 (≠ H375), I335 (≠ L376)
- binding flavin-adenine dinucleotide: A174 (≠ V221), A203 (≠ T249), W206 (≠ R252), I228 (≠ H273), Y252 (= Y295), R308 (= R348), S333 (≠ Q374), R334 (≠ H375), I335 (≠ L376), G336 (= G377), V337 (≠ L378), Q338 (≠ T379)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
27% identity, 65% coverage: 143:409/409 of query aligns to 93:368/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ V221), A203 (≠ T249), W206 (≠ R252), G226 (= G271), G306 (= G346), R308 (= R348), S333 (≠ Q374), R334 (≠ H375), I335 (≠ L376), G336 (= G377), V337 (≠ L378), Q338 (≠ T379)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
Query Sequence
>BPHYT_RS26530 FitnessBrowser__BFirm:BPHYT_RS26530
MPEIAIIGAGFIGLASAVALMRDGHRVTLFDPAGVGQGASFGNAGTFAHYACIPVNNPSV
FRDLPRFLLSNQSPFRLRWGYLPHLTPWLVRFMMSSLPQRYETSAGALAALLDCAQDGYA
PLLANAELARFVRPRECLYLYSNAASFDAARPALDLRHKLGVAFEVLDGAAIRALEPALA
PIFERGVLFSNSWHFSDPQGFLQTLYEQLAAQGLKLERSTVDAVQPGTDSASLTVGGMTR
RFDHVVVATGARSAQFASQCGDSVPLDTERGYHVRFPGAQQLVSRPVGWAERGFYMTPMS
DGLRVAGTVELAGFGDTRNRSLLDLLTFSSKRALPALDTPDSDWLGFRPTLPDGVPVLAR
SRASARVIYAFGHQHLGLTLAGVSGRIVADLIAQRAPPLDLAPYAATRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory