Comparing BPHYT_RS26640 FitnessBrowser__BFirm:BPHYT_RS26640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
75% identity, 98% coverage: 1:293/300 of query aligns to 27:319/323 of 4dz4B
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
51% identity, 94% coverage: 11:293/300 of query aligns to 27:304/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
51% identity, 94% coverage: 11:293/300 of query aligns to 17:294/294 of 7lolA
7lbaB E. Coli agmatinase (see paper)
52% identity, 93% coverage: 11:288/300 of query aligns to 34:306/310 of 7lbaB
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
50% identity, 94% coverage: 11:293/300 of query aligns to 13:284/284 of 7loxA
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
42% identity, 96% coverage: 2:289/300 of query aligns to 14:310/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
42% identity, 96% coverage: 2:289/300 of query aligns to 17:313/319 of Q9I3S3
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
41% identity, 96% coverage: 2:289/300 of query aligns to 17:310/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
41% identity, 96% coverage: 2:289/300 of query aligns to 14:307/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
41% identity, 96% coverage: 2:289/300 of query aligns to 15:308/316 of 3nipB
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
41% identity, 95% coverage: 2:286/300 of query aligns to 12:302/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
41% identity, 95% coverage: 2:286/300 of query aligns to 4:294/301 of 1gq6B
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
35% identity, 95% coverage: 2:286/300 of query aligns to 54:351/378 of 7esrA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 89% coverage: 23:289/300 of query aligns to 24:283/284 of Q57757
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
29% identity, 92% coverage: 21:295/300 of query aligns to 6:276/276 of 3lhlA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
31% identity, 90% coverage: 15:285/300 of query aligns to 32:312/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 90% coverage: 15:285/300 of query aligns to 56:336/342 of P46637
Sites not aligning to the query:
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
30% identity, 86% coverage: 24:281/300 of query aligns to 27:278/293 of 3pzlB
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
30% identity, 95% coverage: 2:287/300 of query aligns to 7:296/303 of 1wogA
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
28% identity, 92% coverage: 15:289/300 of query aligns to 52:336/338 of G7JFU5
>BPHYT_RS26640 FitnessBrowser__BFirm:BPHYT_RS26640
TYAGVLSFMRRPYSRDLTGVDVAVSGIPLDLATTFRPGTRFGPAGVRAASVQLAELGAFP
WGVDPFDHLNVVDYGDCWFDAHNPLGIRDAIIAHARGILASGARMLTFGGDHYITYPLLV
AHVEKYGKPLSLIHFDAHCDTWPDDNPDSLNHGTMFYKAIRERLVDPARSVQIGIRTWND
DFMGVRILDAPWVHRNGTQAAIDEVLSIVGNAPAYLTFDIDCLDPAFAPGTGTPVAGGLS
SAQALEIVRALGAVNLVGADVVEVSPPYDHSDVTALAAAHLASDMLCLMRNQKLQRLTNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory