SitesBLAST
Comparing BPHYT_RS26755 FitnessBrowser__BFirm:BPHYT_RS26755 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3tatA Tyrosine aminotransferase from e. Coli (see paper)
58% identity, 99% coverage: 1:396/399 of query aligns to 1:397/397 of 3tatA
- active site: W131 (= W130), D212 (= D211), A214 (= A213), K247 (= K246)
- binding pyridoxal-5'-phosphate: G103 (= G102), G104 (= G103), S105 (= S104), H179 (= H178), N184 (= N183), A214 (= A213), S246 (= S245), K247 (= K246), R255 (= R254)
3fslA Crystal structure of tyrosine aminotransferase tripple mutant (p181q, r183g,a321k) from escherichia coli at 2.35 a resolution
57% identity, 99% coverage: 1:396/399 of query aligns to 1:397/397 of 3fslA
- active site: W131 (= W130), D212 (= D211), A214 (= A213), K247 (= K246)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G103 (= G102), G104 (= G103), S105 (= S104), W131 (= W130), N184 (= N183), D212 (= D211), A214 (= A213), Y215 (= Y214), S244 (= S243), S246 (= S245), K247 (= K246), R255 (= R254)
6zvgA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with substrate analog - l-indole-3-lactic acid (see paper)
51% identity, 99% coverage: 1:397/399 of query aligns to 1:397/398 of 6zvgA
- binding 3-(indol-3-yl) lactate: D11 (= D11), I13 (= I13), L14 (= L14), I33 (= I33), G34 (= G34), W130 (= W130), K246 (= K246), R374 (= R374)
- binding pyridoxal-5'-phosphate: G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), N183 (= N183), D211 (= D211), Y214 (= Y214), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
6zurA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with substrate analog - l-p-hydroxyphenyllactic acid (see paper)
51% identity, 99% coverage: 1:397/399 of query aligns to 1:397/398 of 6zurA
- binding pyridoxal-5'-phosphate: G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), D211 (= D211), A213 (= A213), Y214 (= Y214), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
- binding (2S)-2-hydroxy-3-(4-hydroxyphenyl)propanoic acid: G34 (= G34), W130 (= W130), R374 (= R374)
6zupA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with substrate analog - l-(-)-3-phenyllactic acid (see paper)
51% identity, 99% coverage: 1:397/399 of query aligns to 1:397/398 of 6zupA
- binding alpha-hydroxy-beta-phenyl-propionic acid: I13 (= I13), I33 (= I33), G34 (= G34), W130 (= W130), K246 (= K246), R374 (= R374)
- binding pyridoxal-5'-phosphate: G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), N183 (= N183), D211 (= D211), A213 (= A213), Y214 (= Y214), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
4rkdC Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with aspartic acid (see paper)
51% identity, 99% coverage: 1:397/399 of query aligns to 1:397/398 of 4rkdC
- active site: W130 (= W130), D211 (= D211), A213 (= A213), K246 (= K246)
- binding oxaloacetate ion: Y65 (= Y65), R280 (= R280)
- binding pyridoxal-5'-phosphate: G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), N183 (= N183), D211 (= D211), Y214 (= Y214), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
4rkdA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with aspartic acid (see paper)
51% identity, 99% coverage: 1:397/399 of query aligns to 1:397/398 of 4rkdA
- active site: W130 (= W130), D211 (= D211), A213 (= A213), K246 (= K246)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethylene)-amino]-succinic acid: G34 (= G34), G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), D211 (= D211), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
- binding pyridoxal-5'-phosphate: G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), D211 (= D211), A213 (= A213), Y214 (= Y214), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
4rkcA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 (see paper)
51% identity, 99% coverage: 1:397/399 of query aligns to 1:397/398 of 4rkcA
- active site: W130 (= W130), D211 (= D211), A213 (= A213), K246 (= K246)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G102 (= G102), G103 (= G103), S104 (= S104), W130 (= W130), D211 (= D211), A213 (= A213), Y214 (= Y214), S243 (= S243), S245 (= S245), K246 (= K246), R254 (= R254)
P05202 Aspartate aminotransferase, mitochondrial; mAspAT; Fatty acid-binding protein; FABP-1; Glutamate oxaloacetate transaminase 2; Kynurenine aminotransferase 4; Kynurenine aminotransferase IV; Kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; Plasma membrane-associated fatty acid-binding protein; FABPpm; Transaminase A; EC 2.6.1.1; EC 2.6.1.7 from Mus musculus (Mouse) (see paper)
44% identity, 99% coverage: 2:397/399 of query aligns to 33:430/430 of P05202
- L209 (= L177) mutation Missing: Heterozygous mice are viable and healthy. Results in early lethality at homozygosity.
- R337 (= R304) mutation to G: Heterozygous mice are viable and healthy. Results in early lethality at homozygosity.
3pd6A Crystal structure of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-iv (see paper)
44% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 3pd6A
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: W133 (= W130), R378 (= R374)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), H181 (= H178), N186 (= N183), D214 (= D211), Y217 (= Y214), S247 (= S243), R258 (= R254)
P12344 Aspartate aminotransferase, mitochondrial; mAspAT; Fatty acid-binding protein; FABP-1; Glutamate oxaloacetate transaminase 2; Kynurenine aminotransferase 4; Kynurenine aminotransferase IV; Kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; Plasma membrane-associated fatty acid-binding protein; FABPpm; Transaminase A; EC 2.6.1.1 from Bos taurus (Bovine) (see 2 papers)
44% identity, 99% coverage: 4:397/399 of query aligns to 35:430/430 of P12344
- K309 (≠ M276) modified: N6-succinyllysine; alternate
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
8skrA Aspartate aminotransferase, mitochondrial (see paper)
44% identity, 99% coverage: 2:397/399 of query aligns to 5:402/402 of 8skrA
- binding pyridoxal-5'-phosphate: S105 (≠ G102), G106 (= G103), T107 (≠ S104), W134 (= W130), N187 (= N183), D215 (= D211), A217 (= A213), Y218 (= Y214), S248 (= S243), K251 (= K246), R259 (= R254)
9aatA X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 9aatA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), A216 (= A213), Y217 (= Y214), S247 (= S243), K250 (= K246), R258 (= R254)
7aatA X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 7aatA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding pyridoxal-5'-phosphate: S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), A216 (= A213), Y217 (= Y214), S247 (= S243), K250 (= K246), R258 (= R254)
1oxoA Aspartate aminotransferase, h-asp complex, open conformation (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 1oxoA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), A216 (= A213), Y217 (= Y214), S247 (= S243), R258 (= R254)
1maqA Crystal structures of true enzymatic reaction intermediates: aspartate and glutamate ketimines in aspartate aminotransferase (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 1maqA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: L16 (= L14), S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), Y217 (= Y214), S247 (= S243), K250 (= K246), R258 (= R254), F352 (= F348), R378 (= R374)
1mapA Crystal structures of true enzymatic reaction intermediates: aspartate and glutamate ketimines in aspartate aminotransferase (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 1mapA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethylene)-amino]-succinic acid: V35 (≠ I33), S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), Y217 (= Y214), S247 (= S243), K250 (= K246), R258 (= R254), R378 (= R374)
1ivrA Structure of aspartate aminotransferase (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 1ivrA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding n-pyridoxyl-2,3-dihydroxyaspartic acid-5-monophosphate: I15 (= I13), V35 (≠ I33), G36 (= G34), S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), A216 (= A213), Y217 (= Y214), S247 (= S243), K250 (= K246), R258 (= R254), R378 (= R374)
1amaA Domain closure in mitochondrial aspartate aminotransferase (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 1amaA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), K250 (= K246)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-2-methyl-succinic acid: I15 (= I13), V35 (≠ I33), G36 (= G34), S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), A216 (= A213), Y217 (= Y214), S247 (= S243), K250 (= K246), R258 (= R254), R378 (= R374)
1akcA Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking its pyridoxal-5'-phosphate-binding lysine residue (see paper)
43% identity, 99% coverage: 2:397/399 of query aligns to 4:401/401 of 1akcA
- active site: W133 (= W130), D214 (= D211), A216 (= A213), H250 (≠ K246)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: V35 (≠ I33), G36 (= G34), S104 (≠ G102), G105 (= G103), T106 (≠ S104), W133 (= W130), N186 (= N183), D214 (= D211), A216 (= A213), Y217 (= Y214), S247 (= S243), R258 (= R254), R378 (= R374)
Query Sequence
>BPHYT_RS26755 FitnessBrowser__BFirm:BPHYT_RS26755
MFDHIPAYPGDPILSLNEDFQLDPRSNKVNLSIGIYFDDAGKLPVMDAVRRAETALLDSI
GPRSYLPMAGLPLYRDAAQALVFGADSEARKAGRIATLQTIGGSGALKVGADFLKRYFPG
SQIWISDPSWENHRVVFEGAGLTVNTYPYYDEHTGGLRFADMIETIDSLPEQSVVLLHAC
CHNPTGVDLSPAQWAELVPVLQRRKLIAFVDMAYQGFGAGLEEDAACVRLLADAGIPLIA
ANSFSKNFSLYGERVGALSVVCKSAEEAGRVLGQLMSTVRANYSNPPTHGARLVANVLAD
ASLRASWEAELATMRERILAMRGTIHAGLAGRVDEVMRARYVAQRGMFTYTGLSESQVER
LRSEYAVYVLRSGRMCVAGLNERNAEYVAASIAAVVSGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory