Comparing BPHYT_RS27170 FitnessBrowser__BFirm:BPHYT_RS27170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
38% identity, 97% coverage: 7:435/442 of query aligns to 19:442/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
38% identity, 97% coverage: 7:435/442 of query aligns to 19:442/451 of 6g4eA
Sites not aligning to the query:
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
38% identity, 97% coverage: 7:435/442 of query aligns to 19:442/453 of 6g4dB
Sites not aligning to the query:
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
37% identity, 99% coverage: 3:439/442 of query aligns to 21:447/448 of 6io1B
Sites not aligning to the query:
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 93% coverage: 19:429/442 of query aligns to 31:437/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 93% coverage: 19:429/442 of query aligns to 33:439/449 of 5lh9D
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
36% identity, 96% coverage: 3:428/442 of query aligns to 19:435/450 of 6gwiB
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
37% identity, 93% coverage: 18:428/442 of query aligns to 36:441/453 of 6s54A
Sites not aligning to the query:
5ghgB Transaminase w58l with smba
39% identity, 93% coverage: 19:429/442 of query aligns to 33:418/433 of 5ghgB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 95% coverage: 14:435/442 of query aligns to 70:488/504 of Q94CE5
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 95% coverage: 15:435/442 of query aligns to 36:453/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 94% coverage: 15:429/442 of query aligns to 32:443/455 of 5kr5A
Sites not aligning to the query:
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
35% identity, 96% coverage: 15:440/442 of query aligns to 36:458/458 of 3gjuA
Sites not aligning to the query:
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
35% identity, 94% coverage: 21:435/442 of query aligns to 35:444/459 of D6R3B6
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
34% identity, 94% coverage: 15:429/442 of query aligns to 2:404/423 of 4a6rA
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
34% identity, 94% coverage: 15:429/442 of query aligns to 30:435/453 of 6s4gA
Sites not aligning to the query:
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
34% identity, 94% coverage: 15:429/442 of query aligns to 3:408/427 of 4ba5A
7q9xAAA Probable aminotransferase
34% identity, 94% coverage: 15:429/442 of query aligns to 31:436/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
34% identity, 94% coverage: 15:429/442 of query aligns to 31:436/455 of 4a6tC
Sites not aligning to the query:
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 98% coverage: 2:435/442 of query aligns to 20:450/458 of 5kr3A
>BPHYT_RS27170 FitnessBrowser__BFirm:BPHYT_RS27170
MSTVFHRLPKQSLPVAVAGDGIEIIDSTGKRYIDASGGAAVSCLGHSNQRVIDAIKRQAQ
QLPYAHTSFFTTAPAEELADRLVASAPQGLEHVYFVSGGSEAIEAALKLARQYFVEKGEP
QRRHFIARRQSYHGNTLGALAIGGNAWRREPFLPILIEAHHVSPCYAYREQRADETEEAF
AQRLADELEQKILELGADTVAAFVAETVVGATAGAVPPVREYFRKIRAVCDRYGVLLILD
EIMSGMGRTGHLYACEEDGVAPDILTIAKGLGAGYQPIGATLVSDRIYQAIVGGSGFFQH
GHTYIGHATACAAALEVQRVIEEDKLLPNVLARGEQLRGQLREHYAQHPHIGDVRGRGLF
VGVELVRDRAGKTPFDARLKLHAVIRREAFARGLMVYPMGGTVDGQIGDHVLLAPPFICT
ERDIDEIVSRFTDAVGGALAAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory