Comparing BPHYT_RS27215 FitnessBrowser__BFirm:BPHYT_RS27215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
25% identity, 60% coverage: 120:349/386 of query aligns to 138:376/483 of 4im7A
Sites not aligning to the query:
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
23% identity, 91% coverage: 1:352/386 of query aligns to 32:399/501 of 7rk5B
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
25% identity, 59% coverage: 146:372/386 of query aligns to 106:329/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
25% identity, 56% coverage: 143:357/386 of query aligns to 108:318/388 of Q4X1A4
>BPHYT_RS27215 FitnessBrowser__BFirm:BPHYT_RS27215
MSEPILQFGTSRFLQAHVALFVSQALERGDAIGGICVVQTTDNPSSQARIAALAQAASYP
VKIRGREGGAIVDTVVDCRAIRAAWIANRDWATIRHAAIHDVRVIVSNTGDMGYRLDERD
SPALLAREGQAPHSYPAKLLTLLHARWRERPDSGISIFPCELVASNGDTLRDLVTGLARQ
WVLPTPFVAYLSQRCIWVNSLVDRIVSEPIEPVGAVAEPYALWAIERRAGMELPCTHEHI
VVTDDLSSYEQLKLFFLNLGHTWLADQWLAQRRSATETVFDAMNDGPLRDGIEAVWDNEV
LPVFSAMGLRARAVQYVASVRERFLNPYLDHRIADIANHHVEKVRRRILPLIELADSLSV
GSGQTRLRETLARHGLTSSTQRADAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory