SitesBLAST
Comparing BPHYT_RS27415 FitnessBrowser__BFirm:BPHYT_RS27415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 73% coverage: 78:392/432 of query aligns to 63:398/446 of A0A0H2VG78
- R102 (= R125) mutation to A: Loss of transport activity.
- I105 (≠ Q128) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E145) mutation to A: Loss of transport activity.
- Q137 (≠ S160) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (≠ Y256) mutation to A: Loss of transport activity.
- N256 (≠ Y261) mutation to A: Loss of transport activity.
- W357 (vs. gap) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 58% coverage: 122:373/432 of query aligns to 130:411/491 of P0AGF4
- R133 (= R125) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E145) mutation to A: Abolishes xylose transport.
- R160 (≠ K152) mutation to A: Abolishes xylose transport.
- Q168 (= Q164) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ M250) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ MT 250:251) binding
- Q289 (≠ T251) mutation to A: Strongly decreases xylose transport.
- N294 (≠ Y256) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ V260) mutation to A: Abolishes xylose transport.
- N325 (= N288) mutation to A: No effect on xylose transport.
- G340 (= G303) mutation to A: Abolishes xylose transport.
- R341 (= R304) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ V354) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E359) mutation to A: Abolishes xylose transport.
- R404 (= R366) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
- 83 G→A: Abolishes xylose transport.
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 58% coverage: 122:373/432 of query aligns to 126:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 58% coverage: 122:373/432 of query aligns to 126:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 58% coverage: 122:373/432 of query aligns to 126:407/475 of 4gbyA
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 28% coverage: 72:191/432 of query aligns to 203:306/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
28% identity, 28% coverage: 72:191/432 of query aligns to 203:306/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 28% coverage: 72:191/432 of query aligns to 217:320/742 of Q02563
Sites not aligning to the query:
- 196:200 mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 mutation Missing: No change in uptake of BoNT/D or BoNT/E.
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Query Sequence
>BPHYT_RS27415 FitnessBrowser__BFirm:BPHYT_RS27415
MHPSPSTLTPARSKAAAVFRVTAGNFLEQFDFFLFGFYATQIANVFFPAASEFASLMMTF
AVFGAGFLMRPLGAIVLGAYIDDVGRRKGLIVTLSIMATGTILIAFVPGYATIGLAAPAL
VLIGRLLQGFSAGAELGGVSVYLAEMATPGRKGLFTSWQSASQQVAIVVAAALGFALNQS
LDAATIAAWGWRVPFFVGCMIVPFIFMLRRNLQETEEFKARQHRPNMKEVLRTLVENWTV
VIAGMMLVAMTTASFYLITVYAPTFGKTVLHLSTADSLLVTLCVAVSNFVWLPIGGALSD
RIGRRPLLVAMTLLAILTAYPALSFLAHAPSFVNMLLALLWLSFMYGIYNGAMVVALTEV
MPAQVRVAGFSLAYSLATAVFGGFTPAISTALIHMTGDKAAPGYWMSFAAACALLATFAL
YRRRAATLTPAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory