SitesBLAST
Comparing BPHYT_RS27425 FitnessBrowser__BFirm:BPHYT_RS27425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
28% identity, 94% coverage: 7:412/433 of query aligns to 13:425/425 of O59010
- S65 (≠ T57) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S268) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SST 268:270) binding
- M311 (≠ L303) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T306) binding
- V355 (= V347) binding
- D394 (≠ S381) binding
- M395 (≠ E382) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R384) mutation to A: Strongly decreased affinity for aspartate.
- N401 (≠ S388) binding
- D405 (≠ N392) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
28% identity, 92% coverage: 7:403/433 of query aligns to 4:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
29% identity, 92% coverage: 7:404/433 of query aligns to 13:417/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (= F38), F46 (= F38), P75 (≠ S67), L91 (= L84), F95 (≠ V88), L130 (= L130), I133 (≠ F133), I159 (≠ L159), Y167 (vs. gap), K196 (≠ R188), G200 (≠ M192), I207 (≠ L199), F210 (= F202), L250 (= L242), I262 (≠ L254), M269 (≠ L261), T334 (= T326), V335 (≠ A327), G336 (≠ P328), T340 (≠ I332), L343 (≠ A335), M399 (≠ L386)
- binding aspartic acid: S277 (= S269), S278 (≠ T270), T314 (= T306), G354 (= G346), A358 (≠ S350), G359 (= G351), D394 (≠ S381), R397 (= R384), T398 (≠ A385)
- binding sodium ion: Y89 (≠ F82), T92 (≠ L85), S93 (≠ T86), G306 (= G298), T308 (≠ S300), N310 (= N302), N310 (= N302), M311 (≠ L303), D312 (= D304), S349 (= S341), I350 (≠ K342), T352 (≠ A344), N401 (≠ S388), V402 (= V389), D405 (≠ N392)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
29% identity, 92% coverage: 7:404/433 of query aligns to 5:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
28% identity, 92% coverage: 7:403/433 of query aligns to 10:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G61), V83 (≠ L79), I157 (≠ L160), Y164 (vs. gap), K193 (≠ R188), T305 (≠ S300), I306 (≠ F301), I347 (≠ K342)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L10), M199 (= M194), S275 (≠ T270), T311 (= T306), G356 (= G351), L384 (≠ V374), D391 (≠ S381), R394 (= R384)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 92% coverage: 7:403/433 of query aligns to 5:408/408 of 6bauA
- binding cysteine: S270 (≠ T270), M303 (≠ L303), T306 (= T306), A345 (= A345), G346 (= G346), V347 (= V347), G351 (= G351), D386 (≠ S381), C389 (≠ R384), T390 (≠ A385), N393 (≠ S388)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
28% identity, 91% coverage: 15:410/433 of query aligns to 12:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S268), S265 (≠ T270), M299 (≠ L303), T302 (= T306), T340 (≠ A344), G342 (= G346), V343 (= V347), G347 (= G351), D383 (≠ S381), R386 (= R384), T387 (≠ A385), N390 (≠ S388)
- binding decyl-beta-d-maltopyranoside: H23 (= H26), V212 (= V217), A216 (≠ G221)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
28% identity, 91% coverage: 15:410/433 of query aligns to 19:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
28% identity, 91% coverage: 15:410/433 of query aligns to 19:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S268), S275 (= S269), S276 (≠ T270), T313 (= T306), G353 (= G346), V354 (= V347), A357 (≠ S350), G358 (= G351), D394 (≠ S381), R397 (= R384), T398 (≠ A385)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R188), G198 (≠ M192), Y202 (≠ L196)
- binding sodium ion: Y87 (≠ F82), T90 (≠ L85), S91 (≠ T86), S276 (≠ T270), G305 (= G298), A306 (≠ Y299), T307 (≠ S300), N309 (= N302), N309 (= N302), M310 (≠ L303), D311 (= D304), S348 (= S341), I349 (≠ K342), G350 (= G343), T351 (≠ A344), N401 (≠ S388), V402 (= V389), D405 (≠ N392)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
28% identity, 91% coverage: 15:410/433 of query aligns to 16:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R188), G195 (≠ M192), R282 (≠ I278)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S268), S272 (= S269), S273 (≠ T270), M307 (≠ L303), T310 (= T306), G353 (= G349), A354 (≠ S350), R394 (= R384), T395 (≠ A385)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
28% identity, 91% coverage: 15:410/433 of query aligns to 17:421/425 of 6zgbA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
30% identity, 78% coverage: 7:343/433 of query aligns to 5:351/396 of 6bmiA
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 87% coverage: 17:393/433 of query aligns to 33:392/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ I71), G89 (≠ A72), G92 (≠ I75), A95 (= A78), V96 (≠ L79), Y99 (≠ F82), M163 (≠ L159), F167 (= F163), F293 (≠ L293), V297 (≠ A297)
- binding aspartic acid: S268 (= S269), S269 (≠ T270), T306 (= T306), G346 (= G346), I347 (≠ V347), A350 (≠ S350), G351 (= G351), D380 (≠ S381), R383 (= R384), T384 (≠ A385)
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
26% identity, 88% coverage: 14:393/433 of query aligns to 58:488/542 of P43003
- S363 (= S268) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ SST 268:270) binding
- T396 (≠ S300) binding
- T402 (= T306) binding
- IPQAG 443:447 (≠ VSGSG 347:351) binding
- D476 (≠ S381) binding
- R477 (≠ E382) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (≠ S388) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
26% identity, 88% coverage: 14:393/433 of query aligns to 58:488/543 of P56564
- N206 (= N136) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ G149) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 87% coverage: 17:393/433 of query aligns to 25:378/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I62), S80 (≠ I71), G81 (≠ A72), G84 (≠ I75), Y91 (≠ F82), M156 (≠ L159), F160 (= F163), F286 (≠ L293), V290 (≠ A297)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V54), I148 (≠ V151), S262 (≠ T270), S263 (≠ E271), A292 (≠ Y299), T293 (≠ S300), M296 (≠ L303), T299 (= T306), G329 (= G343), A336 (≠ S350), G337 (= G351), D366 (≠ S381), R369 (= R384), N373 (≠ S388)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 88% coverage: 15:393/433 of query aligns to 16:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S269), S281 (≠ T270), T318 (= T306), G363 (= G351), M367 (≠ L355), V385 (= V374), D388 (= D377), R395 (= R384), T396 (≠ A385)
- binding dodecyl beta-D-glucopyranoside: V16 (≠ L15), V19 (= V18), I20 (≠ V19), W389 (≠ R378)
- binding cholesterol hemisuccinate: R80 (= R73), R84 (≠ Q77), I95 (≠ V88), I252 (≠ V238)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
26% identity, 88% coverage: 15:393/433 of query aligns to 15:405/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
26% identity, 88% coverage: 15:393/433 of query aligns to 8:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T57), L58 (≠ I58), L65 (= L65), V339 (≠ K342), G340 (= G343), S343 (≠ G346), I344 (≠ V347)
- binding cholesterol: W188 (≠ R195), I227 (≠ L232), F250 (≠ W251), W257 (≠ L261), M379 (≠ A383), S382 (≠ L386)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (≠ T270), M300 (≠ L303), T303 (= T306), Y306 (= Y309), G348 (= G351), L349 (= L352), M352 (≠ L355), I366 (≠ V370), L369 (= L373), V370 (= V374), D373 (= D377), D377 (≠ S381), R380 (= R384), T381 (≠ A385), N384 (≠ S388)
Sites not aligning to the query:
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
26% identity, 87% coverage: 18:393/433 of query aligns to 12:392/406 of 8ctcA
- binding glutamic acid: S268 (= S269), S269 (≠ T270), M303 (≠ L303), T306 (= T306), G346 (= G346), A350 (≠ S350), D380 (≠ S381), R383 (= R384)
- binding sodium ion: Y82 (≠ F82), T85 (≠ L85), T86 (= T86), S269 (≠ T270), G298 (= G298), A299 (≠ Y299), T300 (≠ S300), N302 (= N302), N302 (= N302), M303 (≠ L303), D304 (= D304), S341 (= S341), I342 (≠ K342), G343 (= G343), A344 (= A344), N387 (≠ S388), D391 (≠ N392)
Query Sequence
>BPHYT_RS27425 FitnessBrowser__BFirm:BPHYT_RS27425
MRVAKPLRSLYVQVLLGVVLGIALGHFLPEVGARLRPFSDAFVGLVKMMIAPIVFCTIVS
GITSLASGKAIARTIFQALGLFYLLTAVALALGLVTAFVLQPGAGMHIDAQHLDTSILAQ
YGKHAQPRGLVAFALNVIPETMLGALDKGEVLPVLLLSLLFGFSLNAYPKAGRPVLALID
GIAQTLFRILAMIMRLAPLGAFGAMAFTVGRFGIRSVGSLGMLMVSFYVACLLFVALVLA
PLARLHGFALWRLLRYLREELLIVLATSSTEPVLPRLIAKLEALGCDKGVVGLVLPAGYS
FNLDGTAIYLTLASVFIAQACDVPLTAPQIAIMLAVMLLTSKGAAGVSGSGLVALVATLT
VIPDLPVAGVALLVGIDRFMSEARALTSVISNACAVIFVSMWEGACDRTRLAQMLGAMAP
GGADRSARNTPGT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory