Comparing BPHYT_RS27695 FitnessBrowser__BFirm:BPHYT_RS27695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
42% identity, 44% coverage: 254:459/467 of query aligns to 87:288/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
43% identity, 43% coverage: 254:452/467 of query aligns to 85:279/285 of 3uf6A
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
31% identity, 29% coverage: 6:142/467 of query aligns to 28:163/168 of P86397
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
37% identity, 27% coverage: 16:142/467 of query aligns to 8:134/134 of O32472
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
29% identity, 31% coverage: 12:157/467 of query aligns to 21:163/165 of A0A3Q7HWE4
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 34% coverage: 281:439/467 of query aligns to 536:691/714 of Q8ZND6
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
26% identity, 51% coverage: 201:439/467 of query aligns to 43:306/325 of 1xcoD
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
29% identity, 42% coverage: 242:439/467 of query aligns to 107:309/332 of 2af3C
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
29% identity, 42% coverage: 242:439/467 of query aligns to 108:310/333 of P38503
Sites not aligning to the query:
>BPHYT_RS27695 FitnessBrowser__BFirm:BPHYT_RS27695
MNDNLLRNRTFNEIGIGESASLARVVVQNDIDLFAAVAGDIDPAHEDSVTTNGGPSGHRV
VHGMWTAALISALLGKRLPGPGTIYLGQTWQFRHSVMPGDIITATVTVTEKRTDGRVVVL
DACCTNQAGDTVLLGTATVVAPSTTVVWPCAPSTEVTLRRHDRYEAFIRQARTRPALRTA
IVHPCSAEAIVAAIEARDEGLLEPVLIGPDARIRAAAEAANVDLAGVPIEAVEHSHAAAA
RAVEMGAAGQVAALMKGSLHTDELLGAVVARNSGLRTARRISHVYAMDVPAYSKPLVVTD
AVVNIAPSLDHKRDICQNAIDLLHVLGAELARVAALGAIETVNSRMPATLDAAALTVMAA
RGQITGALVDGPLAFDNAISLAAAKTKQIDSPVAGQADILLVPDLEAGNILAKQLMYFAG
ADAAGLVLGARVPIILTSRADSVRVRLASAALAKLVAERTLAGSGRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory