SitesBLAST
Comparing BPHYT_RS27905 FitnessBrowser__BFirm:BPHYT_RS27905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
24% identity, 80% coverage: 66:411/435 of query aligns to 66:432/496 of P11169
- Q159 (≠ Y167) binding
- QLS 277:279 (≠ TTG 255:257) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (≠ GT 258:259) binding
- N286 (≠ T264) binding
- N315 (vs. gap) binding
- E378 (vs. gap) binding
- W386 (≠ S361) binding
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
24% identity, 80% coverage: 66:411/435 of query aligns to 64:430/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: A66 (= A68), S69 (≠ A71), Q157 (≠ Y167), I164 (≠ Q174), Q278 (≠ G258), Q279 (≠ T259), N284 (≠ T264), N313 (vs. gap), F375 (vs. gap), W384 (≠ S361), N411 (≠ S393), F412 (≠ Y394), G415 (= G396)
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
24% identity, 80% coverage: 66:411/435 of query aligns to 63:429/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: Q156 (≠ Y167), I163 (≠ Q174), Q278 (≠ T259), F286 (≠ V267), A308 (≠ L289), N312 (vs. gap), F374 (vs. gap), E375 (vs. gap), N406 (≠ G390), W407 (vs. gap), N410 (≠ S393)
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
24% identity, 80% coverage: 66:411/435 of query aligns to 66:432/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (≠ Y167), I166 (≠ Q174), Q280 (≠ G258), Q281 (≠ T259), N286 (≠ T264), F377 (vs. gap), W386 (≠ S361)
- binding alpha-D-glucopyranose: Q159 (≠ Y167), I162 (≠ L170), I166 (≠ Q174), Q280 (≠ G258), Q281 (≠ T259), N286 (≠ T264), W386 (≠ S361)
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
24% identity, 80% coverage: 66:411/435 of query aligns to 66:432/470 of 7sptA
Sites not aligning to the query:
5c65A Structure of the human glucose transporter glut3 / slc2a3
25% identity, 59% coverage: 66:322/435 of query aligns to 62:333/457 of 5c65A
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 68% coverage: 85:379/435 of query aligns to 63:375/446 of A0A0H2VG78
- R102 (= R132) mutation to A: Loss of transport activity.
- I105 (≠ Q135) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E152) mutation to A: Loss of transport activity.
- Q137 (≠ Y167) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (≠ G258) mutation to A: Loss of transport activity.
- W357 (≠ S361) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
25% identity, 71% coverage: 79:386/435 of query aligns to 66:409/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
25% identity, 71% coverage: 79:386/435 of query aligns to 66:409/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
25% identity, 71% coverage: 79:386/435 of query aligns to 66:409/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
25% identity, 71% coverage: 79:386/435 of query aligns to 70:413/491 of P0AGF4
- G83 (= G92) mutation to A: Abolishes xylose transport.
- R133 (= R132) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E152) mutation to A: Abolishes xylose transport.
- R160 (= R159) mutation to A: Abolishes xylose transport.
- Q168 (≠ Y167) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ T264) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ TY 264:265) binding
- Q289 (≠ Y265) mutation to A: Strongly decreases xylose transport.
- N294 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y268) mutation to A: Abolishes xylose transport.
- N325 (≠ Q299) mutation to A: No effect on xylose transport.
- G340 (= G310) mutation to A: Abolishes xylose transport.
- R341 (= R311) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ S361) binding ; mutation to A: Abolishes xylose transport.
- E397 (≠ Q366) mutation to A: Abolishes xylose transport.
- R404 (= R373) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
23% identity, 59% coverage: 68:322/435 of query aligns to 68:341/493 of P32037
Sites not aligning to the query:
- 43 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 52% coverage: 17:243/435 of query aligns to 45:293/587 of P25297
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
25% identity, 41% coverage: 66:242/435 of query aligns to 68:232/492 of P17809
Sites not aligning to the query:
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
5eqiA Human glut1 in complex with cytochalasin b (see paper)
24% identity, 41% coverage: 66:242/435 of query aligns to 60:224/447 of 5eqiA
Sites not aligning to the query:
5eqhA Human glut1 in complex with inhibitor (2~{s})-3-(2-bromophenyl)-2-[2- (4-methoxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
24% identity, 41% coverage: 66:242/435 of query aligns to 60:224/447 of 5eqhA
Sites not aligning to the query:
5eqgA Human glut1 in complex with inhibitor (2~{s})-3-(4-fluorophenyl)-2-[2- (3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
24% identity, 41% coverage: 66:242/435 of query aligns to 60:224/447 of 5eqgA
Sites not aligning to the query:
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
22% identity, 61% coverage: 66:331/435 of query aligns to 68:352/492 of P11166
- M77 (≠ L75) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G92) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R132) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G136) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ Y143) binding
- P149 (≠ R155) to A: in EIG12; uncertain significance
- R153 (= R159) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (= L175) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (vs. gap) mutation to C: Strongly decreases glucose transport.
- L204 (vs. gap) mutation to C: Abolishes glucose transport.
- P205 (vs. gap) mutation to C: Abolishes glucose transport.
- R212 (= R190) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (≠ W196) to S: in EIG12; decreased glucose transport
- R223 (≠ A207) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ L210) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (= R216) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (≠ A227) to V: in EIG12; decreased glucose transport
- A275 (≠ V251) to T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- Q282 (≠ G258) binding
- QQLS 282:285 (≠ GTLA 258:261) natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- G286 (≠ F262) to D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- T295 (≠ N271) to M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- V303 (≠ L279) to L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- G314 (≠ S290) to S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- S324 (≠ Q299) to L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- E329 (≠ D307) to Q: in GLUT1DS1; stabilizes the inward-open conformation
- R333 (= R311) to Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; to W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- G340 (= G319) mutation to C: Strongly decreases glucose transport.
Sites not aligning to the query:
- 34 N → S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→T: Loss of glycosylation site.
- 51 R → H: in EIG12; uncertain significance; dbSNP:rs201815571
- 60 T → M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- 388 binding
- 411 Not glycosylated; binding ; N → S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- 435 natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- 458 R → W: in EIG12; decreased glucose transport; dbSNP:rs13306758
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 51% coverage: 33:256/435 of query aligns to 52:261/444 of Q8NLB7
- D54 (≠ E35) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D38) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R90) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Query Sequence
>BPHYT_RS27905 FitnessBrowser__BFirm:BPHYT_RS27905
MHETTPAELDAATRPLRRRSALRSIAGGSIGNLIEWYDFHVYTTFSIFFAASFFPRENRT
IQLLSTAAIFAIGFLLRPVGSWLIGLYADRRGRRSALTLSVILMCAGSLAIGLCPTYPQI
GMAAPLVLLLARLVQGFSLGGEYGASSVYLSEIARPGHRGFYSSFHYVTLILGQLLATLV
QVVLQALIPRAELIDWGWRVPFITGAALALVAWWVRRNIDETPDFRALDEKDKRGVSLSA
LREHWRPVLLVFGLTTGGTLAFFTYTVYMHNYLVNTVGLSAQTSAWLSLSTLTLFMVVQP
FFGALSDRIGRRPLLLWFGIGGTFGTWPLLTALAHTHSATTAFLLLALALMIVSGYTSVC
SVMKAQLFPARLRALGVGVPYAIATAVFGGTASYAGLWFKSIGHESGFYLYASACIGCTL
IATLSLRSSDMKMES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory